1. Recombinant Proteins
  2. Others
  3. TMEFF2/Tomoregulin-2 Protein, Human (HEK293, His)

TMEFF2/Tomoregulin-2 Protein, Human (HEK293, His)

Cat. No.: HY-P700470
Handling Instructions Technical Support

TMEFF2/Tomoregulin-2 protein serves as a potential survival factor for hippocampal and midbrain neurons, supporting neuronal cell viability.In addition, its shed form may upregulate cancer cell proliferation by promoting ERK1/2 phosphorylation.TMEFF2/Tomoregulin-2 Protein, Human (HEK293, His) is the recombinant human-derived TMEFF2/Tomoregulin-2 protein, expressed by HEK293 , with C-10*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TMEFF2/Tomoregulin-2 protein serves as a potential survival factor for hippocampal and midbrain neurons, supporting neuronal cell viability.In addition, its shed form may upregulate cancer cell proliferation by promoting ERK1/2 phosphorylation.TMEFF2/Tomoregulin-2 Protein, Human (HEK293, His) is the recombinant human-derived TMEFF2/Tomoregulin-2 protein, expressed by HEK293 , with C-10*His labeled tag.

Background

TMEFF2/Tomoregulin-2 Protein emerges as a potential survival factor for hippocampal and mesencephalic neurons, indicating its role in supporting the viability of neural cells. In addition to its neuroprotective function, the shedded form of TMEFF2/Tomoregulin-2 is implicated in up-regulating cancer cell proliferation, potentially by facilitating ERK1/2 phosphorylation. This dual role suggests a complex involvement in both neuronal survival and cancer cell proliferation, highlighting the versatility of TMEFF2 in diverse cellular contexts. Further exploration of the mechanisms underlying TMEFF2's impact on neuronal and cancer cell functions could provide valuable insights into its specific roles and potential therapeutic implications in neural and cancer biology.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Human TMEFF2 at 2 μg/mL can bind Anti-TMEFF2 recombinant antibody, the EC50 is ≤7 ng/mL.

Species

Human

Source

HEK293

Tag

C-10*His

Accession

Q9UIK5 (F41-V320)

Gene ID
Molecular Construction
N-term
TMEFF2 (F41-V320)
Accession # Q9UIK5
10*His
C-term
Protein Length

Extracellular Domain

Synonyms
TMEFF2; transmembrane protein with EGF like and two follistatin like domains 2; TR; HPP1; TPEF; TR-2; TENB2; CT120.2; tomoregulin-2; cancer/testis antigen family 120, member 2; hyperplastic polyposis protein 1; transmembrane protein TENB2; transmembrane protein with EGF-like and two follistatin-like domains
AA Sequence

FPTSLSDCQTPTGWNCSGYDDRENDLFLCDTNTCKFDGECLRIGDTVTCVCQFKCNNDYVPVCGSNGESYQNECYLRQAACKQQSEILVVSEGSCATDAGSGSGDGVHEGSGETSQKETSTCDICQFGAECDEDAEDVWCVCNIDCSQTNFNPLCASDGKSYDNACQIKEASCQKQEKIEVMSLGRCQDNTTTTTKSEDGHYARTDYAENANKLEESAREHHIPCPEHYNGFCMHGKCEHSINMQEPSCRCDAGYTGQHCEKKDYSVLYVVPGPVRFQYV

Molecular Weight

47 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TMEFF2/Tomoregulin-2 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TMEFF2/Tomoregulin-2 Protein, Human (HEK293, His)
Cat. No.:
HY-P700470
Quantity:
MCE Japan Authorized Agent: