1. Recombinant Proteins
  2. Others
  3. TMED9 Protein, Human (HEK293, His)

TMED9 is a key player in vesicle protein trafficking and plays an important role in the early secretory pathway, particularly in COPI vesicle-mediated retrograde transport. It promotes the recruitment of coat isoforms to the membrane, enhances ARFGAP2 activity, and ensures the specific retention of p24 complexes in cis-Golgi membranes, specifically affecting TMED2 and TMED10 localization. TMED9 Protein, Human (HEK293, His) is the recombinant human-derived TMED9 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TMED9 is a key player in vesicle protein trafficking and plays an important role in the early secretory pathway, particularly in COPI vesicle-mediated retrograde transport. It promotes the recruitment of coat isoforms to the membrane, enhances ARFGAP2 activity, and ensures the specific retention of p24 complexes in cis-Golgi membranes, specifically affecting TMED2 and TMED10 localization. TMED9 Protein, Human (HEK293, His) is the recombinant human-derived TMED9 protein, expressed by HEK293 , with C-His labeled tag.

Background

TMED9, a protein intricately involved in vesicular protein trafficking, predominantly operates within the early secretory pathway, particularly in COPI vesicle-mediated retrograde transport, facilitating coatomer recruitment to membranes. It enhances the coatomer-dependent activity of ARFGAP2 and plays a pivotal role in the specific retention of p24 complexes in cis-Golgi membranes, contributing notably to the coupled localization of TMED2 and TMED10 in the cis-Golgi network. Beyond its involvement in retrograde transport, TMED9 is implicated in the organization of intracellular membranes, including the ER-Golgi intermediate compartment and the Golgi apparatus. It further participates in the ER localization of PTPN2 isoform PTPB. TMED9 exhibits a dynamic oligomeric state, existing as a monomer and homodimer in the endoplasmic reticulum, with a predominantly monomeric state in the endoplasmic reticulum-Golgi intermediate compartment and cis-Golgi network. Oligomerization likely occurs with other members of the EMP24/GP25L family, such as TMED2, TMED7, and TMED10. Additionally, TMED9 engages in specific interactions with TMED5, COPG1, PTPN2, SPAST, and STX17, underscoring its multifaceted involvement in intracellular processes.

Biological Activity

Measured in a cell proliferation assay using MCF-7 cells. The ED50 for this effect is 19.86 ng/mL. Corresponding to a specific activity is 5.035×104 Unit/mg.

Species

Human

Source

HEK293

Tag

C-His

Accession

Q9BVK6/NP_059980.2 (L38-R202)

Gene ID
Molecular Construction
N-term
TMED9 (L38-R202)
Accession # Q9BVK6/NP_059980.2
His
C-term
Synonyms
Transmembrane emp24 domain-containing protein 9; GMP25; p24alpha2; p25; GP25L2
AA Sequence

LYFHIGETEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHSNSTKFSLFAGGMLRVHLDIQVGEHANDYAEIAAKDKLSELQLRVRQLVEQVEQIQKEQNYQRWREERFRQTSESTNQR

Molecular Weight

Approximately 20.8 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TMED9 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TMED9 Protein, Human (HEK293, His)
Cat. No.:
HY-P76678
Quantity:
MCE Japan Authorized Agent: