1. Recombinant Proteins
  2. Others
  3. TMED4 Protein, Human (HEK293, His)

The TMED4 protein is complexly involved in vesicular protein trafficking in the early secretory pathway, which is critical for targeting and maintenance of the Golgi apparatus. Its involvement extends to the biosynthesis of secretions, emphasizing its role in processing. TMED4 Protein, Human (HEK293, His) is the recombinant human-derived TMED4 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The TMED4 protein is complexly involved in vesicular protein trafficking in the early secretory pathway, which is critical for targeting and maintenance of the Golgi apparatus. Its involvement extends to the biosynthesis of secretions, emphasizing its role in processing. TMED4 Protein, Human (HEK293, His) is the recombinant human-derived TMED4 protein, expressed by HEK293 , with C-His labeled tag.

Background

TMED4 Protein is intricately involved in vesicular protein trafficking, particularly within the early secretory pathway, contributing to the targeting and maintenance of the Golgi apparatus. Its role extends to the biosynthesis of secreted cargo, with a specific focus on processing. Furthermore, TMED4 demonstrates involvement in the endoplasmic reticulum stress response, showcasing its significance in cellular homeostasis under stress conditions. Additionally, there is potential for TMED4 to play a role in the regulation of the heat-shock response and apoptosis, suggesting its multifaceted contributions to cellular processes beyond vesicular trafficking.

Biological Activity

Measured by its binding ability in a functional ELISA .Immobilized Human TMED4 at 2 μg/mL (100 μL/well) can bind Anti-TMED4 antibody, The ED50 for this effect is 5.903 ng/mL.

Species

Human

Source

HEK293

Tag

C-His

Accession

Q7Z7H5 (L30-R194)

Gene ID
Molecular Construction
N-term
TMED4 (L30-R194)
Accession # Q7Z7H5
His
C-term
Protein Length

Lumenal Domain

Synonyms
Transmembrane emp24 domain-containing protein 4; ERS25; GMP25iso; p24alpha3
AA Sequence

LYFHIGETEKRCFIEEIPDETMVIGNYRTQMWDKQKEVFLPSTPGLGMHVEVKDPDGKVVLSRQYGSEGRFTFTSHTPGDHQICLHSNSTRMALFAGGKLRVHLDIQVGEHANNYPEIAAKDKLTELQLRARQLLDQVEQIQKEQDYQRYREERFRLTSESTNQR

Molecular Weight

Approximately 23-24 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TMED4 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TMED4 Protein, Human (HEK293, His)
Cat. No.:
HY-P77242
Quantity:
MCE Japan Authorized Agent: