1. Recombinant Proteins
  2. CD Antigens
  3. Macrophage CD Proteins Epithelial cell CD Proteins
  4. Tissue Factor/CD142
  5. Tissue Factor Protein, Rat (HEK293, His)

Tissue Factor Protein plays a critical role in blood coagulation.It binds to coagulation factors, activating clotting cascades.Tissue Factor Protein interacts with cells, promoting thrombosis and inflammation.Understanding its functions can aid in developing treatments for blood disorders and cardiovascular diseases.Tissue Factor Protein, Rat (HEK293, His) is the recombinant rat-derived Tissue Factor protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
20 μg In-stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Tissue Factor Protein plays a critical role in blood coagulation.It binds to coagulation factors, activating clotting cascades.Tissue Factor Protein interacts with cells, promoting thrombosis and inflammation.Understanding its functions can aid in developing treatments for blood disorders and cardiovascular diseases.Tissue Factor Protein, Rat (HEK293, His) is the recombinant rat-derived Tissue Factor protein, expressed by HEK293 , with C-His labeled tag.

Background

Tissue Factor (TF) functions as a key initiator of blood coagulation, forming a complex with circulating factor VII or VIIa. This [TF:VIIa] complex is pivotal in activating factors IX or X through specific limited proteolysis. In normal hemostasis, TF plays a crucial role by initiating the cell-surface assembly and propagation of the coagulation protease cascade. Additionally, TF interacts with HSPE; however, this interaction is inhibited by heparin. Notably, this interaction promotes the generation of activated factor X and activates coagulation in the presence of activated factor VII, emphasizing the multifaceted role of TF in the intricate processes of blood clotting.

Species

Rat

Source

HEK293

Tag

C-His

Accession

Q66HI4 (M1-E252)

Gene ID
Molecular Construction
N-term
Tissue Factor (M1-E252)
Accession # Q66HI4
His
C-term
Protein Length

Partial

Synonyms
CD142; Coagulation Factor III; F3; TF; TFA; Tissue Factor
AA Sequence

MAIPMRPRLLAALAPTFLGFLLLQVAAGAGTPPGKAFNLTWISTDFKTILEWQPKPTNYTYTVQISDRSRNWKYKCTGTTDTECDLTDEIVKDVNWTYEARVLSVPWRNSTHGKETLFGTHGEEPPFTNARKFLPYRDTKIGQPVIQKYEQDGTKLKVTVKDSFTLVRKNGTFLTLRQVFGNDLGYILTYRKDSSTGRKTNTTHTNEFLIDVEKGVSYCFFVQAVIFSRKTNHKSPESITKCTEQWKSVLGE

Molecular Weight

47-52 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Tissue Factor Protein, Rat (HEK293, His)
Cat. No.:
HY-P73592
Quantity:
MCE Japan Authorized Agent: