1. Recombinant Proteins
  2. CD Antigens
  3. Macrophage CD Proteins Epithelial cell CD Proteins
  4. Tissue Factor/CD142
  5. Tissue Factor Protein, Mouse (HEK293, His)

Tissue factor (TF) initiates blood coagulation by forming a complex with circulating factor VII or VIIa, thus forming the [TF:VIIa] complex. This complex is capable of specific limited proteolysis of factors IX or X and plays a key role in normal hemostasis by initiating the coagulation protease cascade. Tissue Factor Protein, Mouse (HEK293, His) is the recombinant mouse-derived Tissue Factor protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Tissue factor (TF) initiates blood coagulation by forming a complex with circulating factor VII or VIIa, thus forming the [TF:VIIa] complex. This complex is capable of specific limited proteolysis of factors IX or X and plays a key role in normal hemostasis by initiating the coagulation protease cascade. Tissue Factor Protein, Mouse (HEK293, His) is the recombinant mouse-derived Tissue Factor protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Tissue Factor (TF) serves as a crucial initiator of blood coagulation through its formation of a complex with circulating factor VII or VIIa. The resulting [TF:VIIa] complex facilitates the specific limited proteolysis of factors IX or X, thereby playing a pivotal role in normal hemostasis by initiating the cell-surface assembly and propagation of the coagulation protease cascade. Notably, TF's interaction with HSPE is significant, with heparin acting as an inhibitor; this interaction promotes the generation of activated factor X and activates coagulation in the presence of activated factor VII, underscoring TF's intricate involvement in the regulation of blood clotting processes.

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

P20352 (A29-E251)

Gene ID
Molecular Construction
N-term
Tissue Factor (A29-E251)
Accession # P20352
6*His
C-term
Synonyms
Tissue factor; TF; Coagulation factor III;
AA Sequence

AGIPEKAFNLTWISTDFKTILEWQPKPTNYTYTVQISDRSRNWKNKCFSTTDTECDLTDEIVKDVTWAYEAKVLSVPRRNSVHGDGDQLVIHGEEPPFTNAPKFLPYRDTNLGQPVIQQFEQDGRKLNVVVKDSLTLVRKNGTFLTLRQVFGKDLGYIITYRKGSSTGKKTNITNTNEFSIDVEEGVSYCFFVQAMIFSRKTNQNSPGSSTVCTEQWKSFLGE

Molecular Weight

35-42 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 0.05% Brij35, pH 7.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

Tissue Factor Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Tissue Factor Protein, Mouse (HEK293, His)
Cat. No.:
HY-P71127
Quantity:
MCE Japan Authorized Agent: