1. Recombinant Proteins
  2. CD Antigens
  3. Macrophage CD Proteins Epithelial cell CD Proteins
  4. Tissue Factor/CD142
  5. Tissue Factor Protein, Cynomolgus (HEK293, His)

Tissue Factor Protein, Cynomolgus (HEK293, His)

Cat. No.: HY-P78592
Handling Instructions Technical Support

F3 Protein, a cell surface receptor, plays a significant role in regulating blood coagulation and promoting cell adhesion. Dysregulation of F3 Protein has been associated with various disorders, including thrombosis and cancer. Targeting F3 Protein may offer potential therapeutic interventions in these conditions by inhibiting blood clot formation and preventing tumor cell adhesion and metastasis. Tissue Factor Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Tissue Factor protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

F3 Protein, a cell surface receptor, plays a significant role in regulating blood coagulation and promoting cell adhesion. Dysregulation of F3 Protein has been associated with various disorders, including thrombosis and cancer. Targeting F3 Protein may offer potential therapeutic interventions in these conditions by inhibiting blood clot formation and preventing tumor cell adhesion and metastasis. Tissue Factor Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Tissue Factor protein, expressed by HEK293 , with C-His labeled tag.

Background

F3 Protein, also known as tissue factor (TF), serves as the initiator of blood coagulation by forming a complex with circulating factor VII or VIIa. This complex, [TF:VIIa], triggers the activation of factors IX or X through specific limited proteolysis. In normal hemostasis, TF plays a crucial role in initiating the assembly and propagation of the coagulation protease cascade on the cell surface. Furthermore, F3 Protein interacts with HSPE, and this interaction is hindered by heparin. The interaction promotes the generation of activated factor X and activates coagulation in the presence of activated factor VII.

Biological Activity

Measured by its ability to activate Coagulation Factor VII in cleaving a fluorogenic peptide substrate Boc-VPR-AMC. The AC50 is 6.991 μg/mL, as measured under the described conditions, corresponding to a specific activity is 143.041 units/mg.

Species

Cynomolgus

Source

HEK293

Tag

C-His

Accession

A0A2K5VX02 (S33-E252)

Gene ID

102131431

Molecular Construction
N-term
Tissue Factor (S33-E252)
Accession # A0A2K5VX02
His
C-term
Protein Length

Partial

Synonyms
Coagulation Factor III; Tissue Factor; TF; F3; CD142
AA Sequence

SGTTNTVAAYNLTWKSTNFKTILEWEPKPINQVYTVQISTKSGDWKSKCFYTADTECDLTDEIVKDVKQTYLARVFSYPAGHVESTGSTEEPPYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVQDEWTLVRRNDTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRRTANRKSTDSPVECMGHEKGESRE

Molecular Weight

approximately 34-50 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 150 mM NaCl, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Tissue Factor Protein, Cynomolgus (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Tissue Factor Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P78592
Quantity:
MCE Japan Authorized Agent: