1. Recombinant Proteins
  2. Others
  3. TIM-16 Protein, S. cerevisiae

TIM-16 protein is an important component of the PAM complex, which uses ATP to promote the transfer of transit peptide-containing proteins from the inner membrane to the mitochondrial matrix. TIM-16 Protein, S. cerevisiae is the recombinant TIM-16 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TIM-16 protein is an important component of the PAM complex, which uses ATP to promote the transfer of transit peptide-containing proteins from the inner membrane to the mitochondrial matrix. TIM-16 Protein, S. cerevisiae is the recombinant TIM-16 protein, expressed by E. coli , with tag free.

Background

TIM-16 stands as a pivotal constituent of the PAM complex, an essential assembly dedicated to the ATP-dependent translocation of transit peptide-containing proteins from the inner mitochondrial membrane into the mitochondrial matrix. Within this intricate complex, TIM-16 plays a crucial role in orchestrating the activity of mtHSP70 (SSC1) by engaging in a pivotal interaction with PAM18/TIM14. The strategic positioning of PAM18/TIM14 by TIM-16 at the translocon appears to optimize ATPase stimulation, thereby facilitating the efficient translocation process. TIM-16 exhibits a dynamic existence, forming homodimers and heterodimers with PAM18. While homodimerization might not hold significance in vivo, heterodimerization emerges as an indispensable prerequisite for the regulatory influence on mtHSP70 activity. As an integral component of the larger PAM complex, TIM-16 collaborates harmoniously with mtHSP70, MGE1, TIM44, PAM17, and PAM18, collectively contributing to the intricate machinery orchestrating mitochondrial protein translocation. Additionally, TIM-16 engages in interactions with MDJ2, further expanding its network of molecular associations within the mitochondrial environment.

Species

Others

Source

E. coli

Tag

Tag Free

Accession

P42949 (T54-A119)

Gene ID

853340  [NCBI]

Molecular Construction
N-term
TIM-16 (T54-A119)
Accession # P42949
C-term
Protein Length

Partial

Synonyms
Mitochondrial import inner membrane translocase subunit TIM16; Presequence translocated-associated motor subunit PAM16; PAM16; TIM16
AA Sequence

TLDESCKILNIEESKGDLNMDKINNRFNYLFEVNDKEKGGSFYLQSKVYRAAERLKWELAQREKNA

Predicted Molecular Mass
7.9 kDa
Molecular Weight

Approximately 11 kDa,based on SDS-PAGE under reducing conditions.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

TIM-16 Protein, S. cerevisiae Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TIM-16 Protein, S. cerevisiae
Cat. No.:
HY-P71367
Quantity:
MCE Japan Authorized Agent: