1. Recombinant Proteins
  2. Biotinylated Proteins
  3. TIM-4/TIMD-4 Protein, Human (Biotinylated, HEK293, His)

TIM-4/TIMD-4 Protein, Human (Biotinylated, HEK293, His)

Cat. No.: HY-P75552
Handling Instructions Technical Support

TIM-4/TIMD-4 protein is a multifunctional phosphatidylserine receptor involved in multiple immune response functions. It participates in phagocytosis of apoptotic cells and exerts a bimodal regulatory effect on T cell activation—inhibiting initial T cell activation while promoting the proliferation of activated T cells through AKT1 and ERK1/2 phosphorylation. TIM-4/TIMD-4 Protein, Human (Biotinylated, HEK293, His) is the recombinant human-derived TIM-4/TIMD-4 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TIM-4/TIMD-4 protein is a multifunctional phosphatidylserine receptor involved in multiple immune response functions. It participates in phagocytosis of apoptotic cells and exerts a bimodal regulatory effect on T cell activation—inhibiting initial T cell activation while promoting the proliferation of activated T cells through AKT1 and ERK1/2 phosphorylation. TIM-4/TIMD-4 Protein, Human (Biotinylated, HEK293, His) is the recombinant human-derived TIM-4/TIMD-4 protein, expressed by HEK293 , with C-His labeled tag.

Background

TIM-4/TIMD-4 Protein is a versatile phosphatidylserine receptor that plays multiple roles in immune response. It is involved in the phagocytosis of apoptotic cells and regulates T-cell activation in a bimodal manner, inhibiting naive T-cell activation while promoting the proliferation of activated T-cells through AKT1 and ERK1/2 phosphorylation and subsequent signaling pathways. TIM-4/TIMD-4 also participates in efferocytosis, the process of removing apoptotic cells by phagocytes, by directly binding to phosphatidylserine on apoptotic cells. It additionally promotes autophagy by suppressing NLRP3 inflammasome activity via the activation of the LKB1/PRKAA1 pathway in a phosphatidylserine-dependent mechanism. In the context of microbial infection, TIM-4/TIMD-4 plays a positive role in the exosome-mediated trafficking of HIV-1 virus and its entry into immune cells.

Species

Human

Source

HEK293

Tag

C-His

Accession

AAH08988.1 (E25-L315)

Gene ID
Molecular Construction
N-term
TIM-4 (E25-L315)
Accession # AAH08988.1
His
C-term
Protein Length

Partial

Synonyms
T-cell immunoglobulin and mucin domain-containing protein 4; TIMD4; TIM4
AA Sequence

MSKEPLILWLMIEFWWLYLTPVTSETVVTEVLGHRVTLPCLYSSWSHNSNSMCWGKDQCPYSGCKEALIRTDGMRVTSRKSAKYRLQGTIPRGDVSLTILNPSESDSGVYCCRIEVPGWFNDVKINVRLNLQRASTTTHRTATTTTRRTTTTSPTTTRQMTTTPAALPTTVVTTPDLTTGTPLQMTTIAVFTTANTCLSLTPSTLPEEATGLLTPEPSKEGPILTAESETVLPSDSWSSVESTSADTVLLTSKESKVWDLPSTSHVSMWKTSDSVSSPQPGASDTAVPEQNKTTKTGQMDGIPMSMKNEMPISQL

Predicted Molecular Mass
32.7 kDa
Glycosylation
Yes
Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

TIM-4/TIMD-4 Protein, Human (Biotinylated, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TIM-4/TIMD-4 Protein, Human (Biotinylated, HEK293, His)
Cat. No.:
HY-P75552
Quantity:
MCE Japan Authorized Agent: