TIM-1/KIM-1/HAVCR Protein, Canine (HEK293, His)

TIM-1/KIM-1/HAVCR Protein, Canine (HEK293, His) is the recombinant canine-derived TIM-1/KIM-1/HAVCR, expressed by HEK293 , with N-His labeled tag. ,

TIM1 belongs to a family of immunoglobulin-like domain-containing transmembrane proteins that include three members in humans (human TIM1, TIM3, and TIM4) and eight members in mice (murine TIM1 to TIM8), of which the human TIM1, TIM3, and TIM4 are direct orthologs of murine TIM1, TIM3, and TIM4, respectively. These proteins are expressed on the cell surface, with their N-terminal immunoglobulin-like (IgV) and mucin domains present in the extracellular milieu and their C-terminal sequences in the cytoplasm. An important feature of all TIM proteins is a highly conserved phosphatidylserine (PtdSer)-binding pocket in the IgV domain that recognizes PtdSer on the outer membrane leaflet of apoptotic cells, facilitating their uptake by phagocytic cells^[1].
TIM-1 is a type I membrane protein with an IgV domain followed by a heavily glycoslyated mucin domain, a transmembrane domain and an intracellular cytoplasmic tail with one tyrosine phosphorylation motif. TIM-1 can function as a co-stimulatory molecule for T cell activation. Cross-linking Tim-1 with antibodies, in conjunction with TCR and CD28 stimulation, enhances the proliferation of CD4+ T cells. over-expression of Tim-1 leads to NFAT/AP-1 transcriptional activation, dependent on Y276 in the cytoplasmic tail^[2].

Canine

HEK293

N-His

NP_001192043/XP_854888.1 (Y21-S160)

612069  [NCBI]

Partial

YVQVNGVVGHPATLPCTYSTASGVTTMCWGRGACPISHCLEEIVWTNGSHVTFQKHLRYKLKGKLSEGDVSLTIENAAQTDSGQYCCRVEHRGWFNDMKLTLSLEIKPDGNGTVTQSSDGLWHNNQTHVSLAQNSWMTTS

Approximately 32-40 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE. It migrates as an approximately 32-40 kDa band in SDS-PAGE under reducing conditions due to glycosylation.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.