1. Recombinant Proteins
  2. Others
  3. THSD1 Protein, Mouse (HEK293, His)

THSD1 protein actively regulates the assembly of nascent focal adhesions and affects the attachment of endothelial cells to the extracellular matrix. As a key player, THSD1 forms a complex with PTK2/FAK1, TLN1 and VCL and contributes to focal adhesion dynamics. THSD1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived THSD1 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

THSD1 protein actively regulates the assembly of nascent focal adhesions and affects the attachment of endothelial cells to the extracellular matrix. As a key player, THSD1 forms a complex with PTK2/FAK1, TLN1 and VCL and contributes to focal adhesion dynamics. THSD1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived THSD1 protein, expressed by HEK293 , with C-His labeled tag.

Background

THSD1 emerges as a positive regulator in the assembly of nascent focal adhesions, exerting its influence on the modulation of endothelial cell attachment to the extracellular matrix. As a key participant in this cellular process, THSD1 forms a complex with PTK2/FAK1, TLN1, and VCL, collectively contributing to the intricate orchestration of focal adhesion dynamics. The interaction between THSD1 and TLN1 underscores its involvement in the molecular machinery governing cell-matrix interactions, highlighting its significance in the regulation of focal adhesion formation and endothelial cell adhesion to the extracellular matrix.

Species

Mouse

Source

HEK293

Tag

C-His

Accession

Q9JM61/NP_062522.1 (E25-N412)

Gene ID
Molecular Construction
N-term
THSD1 (E25-N412)
Accession # Q9JM61/NP_062522.1
His
C-term
Protein Length

Extracellular Domain

Synonyms
Thrombospondin Type-1 Domain-Containing Protein 1; THSD1; TMTSP
AA Sequence

EYLLLQEPVHVALSDRTVSVGFHYLSDVNGTLRNVSVMLWEANTNRTLTTKYLLTNQAQGTLQFECFYFKEAGDYWFVMIPEVTDNGTQVPLWEKSAFLKVEWPVFHIDLNRTAKAAEGTFQVGVFTTQPLCLFPVDKPDMLVDVIFTDRLPEARASLGQPLEIRASKRTKLTQGQWVEFGCAPVGVEAYVTVMLRLLGQDSVIASTGPIDLAQKFGYKLMMAPEVTCESVLEVMVLPPPCVFVQGVLAVYKEAPKRPEERTFQVAENRLPLGERRTVFNCTLFDVGKNKYCFNFGIVKKGHFSAKECMLIQRNIETWGPWQPWSPCSTTCGDAVRERRRLCVTSFPSRPSCSGMSSETSPCSLEECAVFRPPGPSPVSPQDPVKSNN

Molecular Weight

Approximately 60-70 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

THSD1 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
THSD1 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P77231
Quantity:
MCE Japan Authorized Agent: