TPO/Thrombopoietin Protein, Human (CHO, His)

TPO/Thrombopoietin Protein, Human (CHO, His), also called megakaryocyte growth and development factor, is a cytokine that regulates megakaryocyte and platelet production.

Recombinant thrombopoietin reduced radiation- and chemotherapy-induced thrombocytopenia, enhanced platelet recovery after bone marrow transplantation and increased the number of megakaryocyte precursor cells in stem cell harvests. Injection of thrombopoietin into animals stimulates the number, size and ploidy of bone marrow megakaryocytes and increases the platelet count up to ten-fold^[1]. Superphysiological amounts of Thrombopoietin/TPO (>100 ng/mL) are able to directly activate platelet aggregation in vitro. Thrombopoietin/TPO also has significant effects on platelet adhesion under flow. Low Thrombopoietin/TPO concentrations (001-1 ng/mL) accelerate firm platelet adhesion to von Willebrand factor and prevent de-attachment at higher flow rates^[2].

The ED₅₀ is typically 0.5-5 ng/mL as measured by MO7e human megakaryocytic leukemic cells in a cell proliferation assay.

• 
  The ED₅₀ is 0.95 ng/mL, corresponding to a specific activity is 1.05×10⁶ units/mg, as measured by MO7e human megakaryocytic leukemic cells in a cell proliferation assay.

Human

CHO

C-6*His

P40225 (S22-G353)

7066  [NCBI]

Full Length of Mature Protein

SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG

Approximately 76-93 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.