1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TGF-beta Superfamily Neurotrophic Factors
  4. TGF-β TGF-β
  5. TGF-β1
  6. TGF beta 1/TGFB1 Protein, Xenopus laevis (P. pastoris, His)

TGF beta 1/TGFB1 Protein, Xenopus laevis (P. pastoris, His)

Cat. No.: HY-P700483
Handling Instructions Technical Support

TGFB1 proprotein is the precursor of latency-associated peptide (LAP) and active transforming growth factor Beta-1 (TGF-β-1) chain, which maintains TGF-β-1 latency in the extracellular matrix. Through non-covalent binding, TGFB1 critically regulates TGF-β-1 activation by interacting with “environmental molecules” (LTBP1, LRRC32/GARP, LRRC33/NRROS) that collectively control TGF-β-1 activation. TGF beta 1/TGFB1 Protein, Xenopus laevis (P. pastoris, His) is the recombinant Xenopus laevis-derived TGF beta 1/TGFB1 protein, expressed by P. pastoris , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TGFB1 proprotein is the precursor of latency-associated peptide (LAP) and active transforming growth factor Beta-1 (TGF-β-1) chain, which maintains TGF-β-1 latency in the extracellular matrix. Through non-covalent binding, TGFB1 critically regulates TGF-β-1 activation by interacting with “environmental molecules” (LTBP1, LRRC32/GARP, LRRC33/NRROS) that collectively control TGF-β-1 activation. TGF beta 1/TGFB1 Protein, Xenopus laevis (P. pastoris, His) is the recombinant Xenopus laevis-derived TGF beta 1/TGFB1 protein, expressed by P. pastoris , with N-6*His labeled tag.

Background

The Transforming Growth Factor Beta-1 (TGFB1) proprotein serves as the precursor for both the Latency-associated peptide (LAP) and the active Transforming Growth Factor Beta-1 (TGF-beta-1) chains, constituting the regulatory and active subunit of TGF-beta-1, respectively. It plays a crucial role in maintaining the TGF-beta-1 chain in a latent state during storage within the extracellular matrix. Through a non-covalent association with TGF-beta-1, TGFB1 regulates its activation by interacting with 'milieu molecules' such as LTBP1, LRRC32/GARP, and LRRC33/NRROS, which collectively control the activation of TGF-beta-1. Furthermore, the interaction of TGFB1 with integrins (ITGAV:ITGB6 or ITGAV:ITGB8) induces the distortion of the Latency-associated peptide chain, leading to the subsequent release of active TGF-beta-1.

Species

Xenopus laevis

Source

P. pastoris

Tag

N-6*His

Accession

P16176 (G271-S382)

Gene ID

397778  [NCBI]

Molecular Construction
N-term
6*His
TGFB1 (G271-S382)
Accession # P16176
C-term
Protein Length

Partial

Synonyms
TGF-beta-1; TGFB1; TGFB; rHuTGF-β1
AA Sequence

GVGQEYCFGNNGPNCCVKPLYINFRKDLGWKWIHEPKGYEANYCLGNCPYIWSMDTQYSKVLSLYNQNNPGASISPCCVPDVLEPLPIIYYVGRTAKVEQLSNMVVRSCNCS

Predicted Molecular Mass
14.6 kDa
Molecular Weight

Approximately 15 kDa, based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

TGF beta 1/TGFB1 Protein, Xenopus laevis (P. pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TGF beta 1/TGFB1 Protein, Xenopus laevis (P. pastoris, His)
Cat. No.:
HY-P700483
Quantity:
MCE Japan Authorized Agent: