1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TGF-beta Superfamily Neurotrophic Factors
  4. TGF-β TGF-β
  5. TGF-β1
  6. TGF beta 1/TGFB1 Protein, Oncorhynchus mykiss (P. pastoris, His)

TGF beta 1/TGFB1 Protein, Oncorhynchus mykiss (P. pastoris, His)

Cat. No.: HY-P700474
Handling Instructions Technical Support

TGF beta-1/TGFB1 proprotein is the precursor of latency-associated peptide (LAP) and active transforming growth factor Beta-1 (TGF-beta-1) chain, which maintains TGF-beta-1 latency in the extracellular matrix. It interacts with "environmental molecules" (LTBP1, LRRC32/GARP, LRRC33/NRROS) and plays a crucial regulatory role in the activation of TGF-β-1. TGF beta 1/TGFB1 Protein, Oncorhynchus mykiss (P. pastoris, His) is the recombinant TGF beta 1/TGFB1 protein, expressed by P. pastoris , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TGF beta-1/TGFB1 proprotein is the precursor of latency-associated peptide (LAP) and active transforming growth factor Beta-1 (TGF-beta-1) chain, which maintains TGF-beta-1 latency in the extracellular matrix. It interacts with "environmental molecules" (LTBP1, LRRC32/GARP, LRRC33/NRROS) and plays a crucial regulatory role in the activation of TGF-β-1. TGF beta 1/TGFB1 Protein, Oncorhynchus mykiss (P. pastoris, His) is the recombinant TGF beta 1/TGFB1 protein, expressed by P. pastoris , with N-6*His labeled tag.

Background

The Transforming Growth Factor Beta-1 (TGFB1) proprotein serves as a precursor for both the Latency-associated peptide (LAP) and the active Transforming Growth Factor Beta-1 (TGF-beta-1) chains, which respectively constitute the regulatory and active subunits of TGF-beta-1. It plays a crucial role in maintaining the TGF-beta-1 chain in a latent state during storage within the extracellular matrix. Through non-covalent association with TGF-beta-1, it regulates the activation of TGF-beta-1 by interacting with 'milieu molecules' such as LTBP1, LRRC32/GARP, and LRRC33/NRROS. These interactions are pivotal in controlling the activation of TGF-beta-1. Moreover, the proprotein's interaction with integrins (ITGAV:ITGB6 or ITGAV:ITGB8) leads to the distortion of the Latency-associated peptide chain, resulting in the subsequent release of active TGF-beta-1.

Species

Others

Source

P. pastoris

Tag

N-6*His

Accession

O93449 (Q271-S382)

Gene ID

100136774  [NCBI]

Molecular Construction
N-term
6*His
TGFB1 (Q271-S382)
Accession # O93449
C-term
Protein Length

Full Length of Mature Protein

Synonyms
TGF-beta-1; TGFB1; TGFB; rHuTGF-β1
AA Sequence

QTTTEEICSDKSESCCVRKLYIDFRKDLGWKWIHEPTGYFANYCIGPCTYIWNTENKYSQVLALYKHHNPGASAQPCCVPQVLEPLPIIYYVGRQHKVEQLSNMIVKSCRCS

Molecular Weight

15 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

TGF beta 1/TGFB1 Protein, Oncorhynchus mykiss (P. pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TGF beta 1/TGFB1 Protein, Oncorhynchus mykiss (P. pastoris, His)
Cat. No.:
HY-P700474
Quantity:
MCE Japan Authorized Agent: