1. Recombinant Proteins
  2. Others
  3. TFPI Protein, Human (HEK293, His)

TFPI protein, encoded by the TFPI gene, is an important Kunitz-type serine protease inhibitor that regulates TF-dependent pathways in coagulation. It inhibits factor X and VIIa-TF proteases, preventing excessive clot formation. TFPI Protein, Human (HEK293, His) is the recombinant human-derived TFPI protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TFPI protein, encoded by the TFPI gene, is an important Kunitz-type serine protease inhibitor that regulates TF-dependent pathways in coagulation. It inhibits factor X and VIIa-TF proteases, preventing excessive clot formation. TFPI Protein, Human (HEK293, His) is the recombinant human-derived TFPI protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The TFPI gene encodes a Kunitz-type serine protease inhibitor crucial for regulating the tissue factor (TF)-dependent pathway in blood coagulation. This pathway is initiated by the formation of a factor VIIa-TF complex, activating additional proteases (factors IX and X) and culminating in fibrin clot formation. The TFPI protein acts as an autoregulatory loop inhibitor, targeting both activated factor X and VIIa-TF proteases. In animal models of hemophilia, inhibition of this protein has shown promise in restoring hemostasis. The gene produces multiple protein isoforms, each differing in inhibitory activity, specificity, and cellular localization. Notably, TFPI exhibits broad expression across various tissues, including liver, placenta, and others.

Biological Activity

Measured by its ability to inhibit trypsin cleavage of a fluorogenic peptide substrate, Mca-RPKPVE-Nval-WRK(Dnp)-NH2 (HY-P2185A). The IC50 value is 0.67 nM.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P10646/NP_006278.1(D29-K282)

Gene ID
Molecular Construction
N-term
TFPI (D29-K282)
Accession # NP_006278.1
6*His
C-term
Protein Length

Partial

Synonyms
Tissue factor pathway inhibitor; EPI; LACI; TFPI1
AA Sequence

DSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIK

Molecular Weight

42-45 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TFPI Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TFPI Protein, Human (HEK293, His)
Cat. No.:
HY-P77227
Quantity:
MCE Japan Authorized Agent: