1. Recombinant Proteins
  2. Others
  3. TFIIF-associating CTD phosphatase Protein, Mouse (Myc, His)

TFIIF-associating CTD phosphatase Protein, Mouse (Myc, His)

Cat. No.: HY-P71579
Handling Instructions Technical Support

The TFIIF-related CTD phosphatase protein plays a key role in promoting RNA polymerase II activity by dephosphorylating "Ser-2" and "Ser-5" residues. This enhances the function of RNA polymerase II, allowing the protein to participate in the transcription process. TFIIF-associating CTD phosphatase Protein, Mouse (Myc, His) is the recombinant mouse-derived TFIIF-associating CTD phosphatase protein, expressed by E. coli , with N-His, C-Myc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The TFIIF-related CTD phosphatase protein plays a key role in promoting RNA polymerase II activity by dephosphorylating "Ser-2" and "Ser-5" residues. This enhances the function of RNA polymerase II, allowing the protein to participate in the transcription process. TFIIF-associating CTD phosphatase Protein, Mouse (Myc, His) is the recombinant mouse-derived TFIIF-associating CTD phosphatase protein, expressed by E. coli , with N-His, C-Myc labeled tag.

Background

The TFIIF-associating CTD phosphatase appears to have a critical role in promoting the activity of RNA polymerase II by processively dephosphorylating 'Ser-2' and 'Ser-5' residues within the heptad repeats YSPTSPS in the C-terminal domain of the largest RNA polymerase II subunit. This enzymatic activity enhances the functionality of RNA polymerase II, suggesting its involvement in transcriptional processes. Additionally, the protein contributes to the exit from mitosis by dephosphorylating key mitotic substrates, including USP44, CDC20, and WEE1, which are essential for the inactivation of M-phase-promoting factor (MPF)/CDK1. This dual role underscores the regulatory significance of the TFIIF-associating CTD phosphatase in coordinating both transcriptional and cell cycle processes.

Species

Mouse

Source

E. coli

Tag

N-His;C-Myc

Accession

Q7TSG2-1 (H178-R341)

Gene ID
Molecular Construction
N-term
10*His
FCP1 (H178-R341)
Accession # Q7TSG2-1
Myc
C-term
Protein Length

Partial

Synonyms
Ctdp1; Fcp1; RNA polymerase II subunit A C-terminal domain phosphatase; EC 3.1.3.16; TFIIF-associating CTD phosphatase
AA Sequence

HRNRKLVLMVDLDQTLIHTTEQHCPQMSNKGIFHFQLGRGEPMLHTRLRPHCKDFLEKIAKLYELHVFTFGSRLYAHTIAGFLDPEKKLFSHRILSRDECIDPFSKTGNLRNLFPCGDSMVCIIDDREDVWKFAPNLITVKKYVYFPGTGDVNAPPAARETQAR

Predicted Molecular Mass
24.0 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

TFIIF-associating CTD phosphatase Protein, Mouse (Myc, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TFIIF-associating CTD phosphatase Protein, Mouse (Myc, His)
Cat. No.:
HY-P71579
Quantity:
MCE Japan Authorized Agent: