1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TFF3 Protein, Human (P. pastoris, His)

TFF3 Protein is crucial for maintaining and repairing the intestinal mucosa, promoting epithelial cell mobility as a motogen. As a monomer, TFF3 has individual effects, while as a disulfide-linked homodimer, it enhances cellular responses for intestinal lining integrity. TFF3's multifaceted nature underscores its significance in balancing mucosal maintenance and repair in the gastrointestinal tract. TFF3 Protein, Human (P. pastoris, His) is the recombinant human-derived TFF3 protein, expressed by P. pastoris , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TFF3 Protein is crucial for maintaining and repairing the intestinal mucosa, promoting epithelial cell mobility as a motogen. As a monomer, TFF3 has individual effects, while as a disulfide-linked homodimer, it enhances cellular responses for intestinal lining integrity. TFF3's multifaceted nature underscores its significance in balancing mucosal maintenance and repair in the gastrointestinal tract. TFF3 Protein, Human (P. pastoris, His) is the recombinant human-derived TFF3 protein, expressed by P. pastoris , with N-6*His labeled tag.

Background

TFF3 Protein plays a pivotal role in the maintenance and repair of the intestinal mucosa, actively participating in healing processes by promoting the mobility of epithelial cells as a motogen. Existing both as a monomer and a homodimer, the disulfide-linked homodimeric form suggests a potential collaborative enhancement of its functions. While functioning as a monomer, TFF3 likely exerts individual effects, and as a homodimer, it may synergistically contribute to the dynamic cellular responses crucial for the integrity and restoration of the intestinal lining. The multifaceted nature of TFF3 underscores its significance in orchestrating the intricate balance of mucosal maintenance and repair within the gastrointestinal tract.

Species

Human

Source

P. pastoris

Tag

N-6*His

Accession

Q07654 (L29-V80)

Gene ID
Molecular Construction
N-term
6*His
TFF3 (L29-V80)
Accession # Q07654
C-term
Protein Length

Partial

Synonyms
TFF3; trefoil factor 3 (intestinal); ITF; Polypeptide P1.B; TFI; HITF; trefoil factor 3, HITF, human intestinal trefoil factor; OTTHUMP00000109349; P1B; trefoil factor 3; hITF; hP1.B; Intestinal trefoil factor
AA Sequence

LLSSSSAEEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGV

Predicted Molecular Mass
7.5 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

TFF3 Protein, Human (P. pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TFF3 Protein, Human (P. pastoris, His)
Cat. No.:
HY-P700523
Quantity:
MCE Japan Authorized Agent: