1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TFF3 Protein, Canine (HEK293, His)

TFF3 Protein intricately maintains and repairs the intestinal mucosa, acting as a motogen that promotes epithelial cell mobility during healing. Existing as a monomer, TFF3 can form homodimers through disulfide linkages, suggesting a role in mediating crucial interactions. Its involvement in mucosal repair underscores TFF3's significance in dynamic processes that preserve the integrity and functionality of the intestinal lining. TFF3 Protein, Canine (HEK293, His) is the recombinant canine-derived TFF3 protein, expressed by HEK293 , with C-10*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TFF3 Protein intricately maintains and repairs the intestinal mucosa, acting as a motogen that promotes epithelial cell mobility during healing. Existing as a monomer, TFF3 can form homodimers through disulfide linkages, suggesting a role in mediating crucial interactions. Its involvement in mucosal repair underscores TFF3's significance in dynamic processes that preserve the integrity and functionality of the intestinal lining. TFF3 Protein, Canine (HEK293, His) is the recombinant canine-derived TFF3 protein, expressed by HEK293 , with C-10*His labeled tag.

Background

The TFF3 Protein is intricately involved in the maintenance and repair of the intestinal mucosa, playing a pivotal role in promoting the mobility of epithelial cells during healing processes, acting as a motogen. The protein exists as a monomer and can form homodimers through disulfide linkages. This dimeric structure underscores its potential role in mediating interactions crucial for its functional activities. TFF3's participation in mucosal repair highlights its significance in contributing to the dynamic processes that maintain the integrity and functionality of the intestinal lining.

Species

Canine

Source

HEK293

Tag

C-10*His

Accession

Q863B4 (Y24-F80)

Gene ID
Molecular Construction
N-term
TFF3 (Y24-F80)
Accession # Q863B4
10*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
TFF3; trefoil factor 3 (intestinal); ITF; Polypeptide P1.B; TFI; HITF; trefoil factor 3, HITF, human intestinal trefoil factor; OTTHUMP00000109349; P1B; trefoil factor 3; hITF; hP1.B; Intestinal trefoil factor
AA Sequence

YQGLATNLCEVPPKDRVDCGYPEITSEQCVNRGCCFDSSIHGVPWCFKPLQDTECRF

Predicted Molecular Mass
9.2 kDa
Molecular Weight

Approximately 10 kDa, based on SDS-PAGE under reducing conditions.

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

TFF3 Protein, Canine (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TFF3 Protein, Canine (HEK293, His)
Cat. No.:
HY-P700527
Quantity:
MCE Japan Authorized Agent: