1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TFF2 Protein, Mouse (HEK293, His)

TFF2 Protein inhibits gastrointestinal motility and gastric acid secretion.It is proposed to act as a structural component of gastric mucus, potentially stabilizing glycoproteins within the mucus gel through interactions with carbohydrate side chains.This helps maintain the integrity of the gastric mucosal barrier.TFF2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TFF2 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE TFF2 Protein, Mouse (HEK293, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TFF2 Protein inhibits gastrointestinal motility and gastric acid secretion.It is proposed to act as a structural component of gastric mucus, potentially stabilizing glycoproteins within the mucus gel through interactions with carbohydrate side chains.This helps maintain the integrity of the gastric mucosal barrier.TFF2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TFF2 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

TFF2 (Trefoil Factor 2) functions as an inhibitor of gastrointestinal motility and gastric acid secretion. It is postulated to serve as a structural constituent of gastric mucus, potentially contributing to the stabilization of glycoproteins within the mucus gel through interactions with carbohydrate side chains, thereby playing a role in maintaining the integrity of the gastric mucosal barrier.

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

Q03404 (E24-Y129)

Gene ID
Molecular Construction
N-term
TFF2 (E24-Y129)
Accession # Q03404
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Trefoil Factor 2; Spasmolytic polypeptide; SP; Tff2; Sml1; Sp
AA Sequence

EKPSPCRCSRLTPHNRKNCGFPGITSEQCFDLGCCFDSSVAGVPWCFHPLPNQESEQCVMEVSARKNCGYPGISPEDCASRNCCFSNLIFEVPWCFFPQSVEDCHY

Molecular Weight

Approximately 14.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

TFF2 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TFF2 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P71355
Quantity:
MCE Japan Authorized Agent: