1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TFF1 Protein, Human (P. pastoris, N-His)

TFF1 protein functions as a mucous gel stabilizer, vital for fortifying the gastrointestinal mucosa against noxious agents. It contributes to the mucous layer's integrity, providing a crucial physical barrier for the gastrointestinal tract, safeguarding it from potential harm. TFF1's stabilizing role emphasizes its significance in preserving the mucosal barrier, essential for overall gastrointestinal health and protection. TFF1 Protein, Human (P. pastoris, N-His) is the recombinant human-derived TFF1 protein, expressed by P. pastoris , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TFF1 protein functions as a mucous gel stabilizer, vital for fortifying the gastrointestinal mucosa against noxious agents. It contributes to the mucous layer's integrity, providing a crucial physical barrier for the gastrointestinal tract, safeguarding it from potential harm. TFF1's stabilizing role emphasizes its significance in preserving the mucosal barrier, essential for overall gastrointestinal health and protection. TFF1 Protein, Human (P. pastoris, N-His) is the recombinant human-derived TFF1 protein, expressed by P. pastoris , with N-6*His labeled tag.

Background

Trefoil Factor 1 (TFF1) protein acts as a stabilizer for the mucous gel that overlays the gastrointestinal mucosa, playing a crucial role in providing a robust physical barrier against a variety of noxious agents. By contributing to the integrity of the mucous layer, TFF1 aids in the protection and defense of the gastrointestinal tract from potential harmful substances. Its stabilizing function underscores its importance in maintaining the mucosal barrier, which is essential for the overall health and protection of the gastrointestinal mucosa.

Species

Human

Source

P. pastoris

Tag

N-6*His

Accession

P04155 (E25-F84)

Gene ID
Molecular Construction
N-term
6*His
TFF1 (E25-F84)
Accession # P04155
C-term
Protein Length

Full Length of Mature Protein

Synonyms
TFF1; BCEI; D21S21; HP1.A; HPS2; pNR-2; pS2; trefoil factor 1; gastrointestinal trefoil protein pS2; breast cancer estrogen-inducible sequence; Breast cancer estrogen-inducible protein; breast cancer, estrogen-inducible sequence expressed in gastrointestinal trefoil protein pS2; pS2 protein; trefoil factor, BCE1, human pS2 induced by estrogen from human breast cancer cell line M
AA Sequence

EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF

Predicted Molecular Mass
8.7 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

TFF1 Protein, Human (P. pastoris, N-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TFF1 Protein, Human (P. pastoris, N-His)
Cat. No.:
HY-P700509
Quantity:
MCE Japan Authorized Agent: