TERT Protein, Human (His)

TERT Protein, Human (His) is the recombinant human-derived TERT protein, expressed by E. coli, with N-6*His tag.

TERT is the catalytic subunit of telomerase, a ribonucleoprotein enzyme critical for chromosome end replication in most eukaryotes. It is active in progenitor and cancer cells but exhibits minimal or no activity in normal somatic cells. As the core component of the telomerase holoenzyme complex, TERT elongates telomeres by functioning as a reverse transcriptase that adds TTAGGG repeats to chromosomal termini using an internal RNA template. Its catalytic cycle involves primer binding, extension, and product release upon reaching template boundaries. TERT shows higher activity on substrates containing 2-3 telomeric repeats, with regulation mediated by associated proteins, chaperones, and post-translational modifications. It also modulates Wnt signaling and plays pivotal roles in aging and antiapoptosis processes.

Human

E. coli

N-6*His

O14746-1 (E281-A436)

7015

Partial

EATSLEGALSGTRHSHPSVGRQHHAGPPSTSRPPRPWDTPCPPVYAETKHFLYSSGDKEQLRPSFLLSSLRPSLTGARRLVETIFLGSRPWMPGTPRRLPRLPQRYWQMRPLFLELLGNHAQCPYGVLLKTHCPLRAAVTPAAGVCAREKPQGSVA

Greater than 85% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.