1. Recombinant Proteins
  2. Others
  3. TEAD4 Protein, Human (His)

TEAD4 protein is a transcription factor that plays a key role in the Hippo signaling pathway and is essential for organ size control and tumor suppression. It coordinates proliferation inhibition and apoptosis promotion through a kinase cascade involving MST1/MST2, SAV1, LATS1/2, and MOB1. TEAD4 Protein, Human (His) is the recombinant human-derived TEAD4 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TEAD4 protein is a transcription factor that plays a key role in the Hippo signaling pathway and is essential for organ size control and tumor suppression. It coordinates proliferation inhibition and apoptosis promotion through a kinase cascade involving MST1/MST2, SAV1, LATS1/2, and MOB1. TEAD4 Protein, Human (His) is the recombinant human-derived TEAD4 protein, expressed by E. coli , with N-6*His labeled tag.

Background

TEAD4, a transcription factor, assumes a pivotal role in the Hippo signaling pathway, a regulatory network crucial for organ size control and tumor suppression by orchestrating proliferation inhibition and apoptosis promotion. The pathway's core features a kinase cascade wherein MST1/MST2, in conjunction with its regulatory protein SAV1, phosphorylates and activates LATS1/2 complexed with its regulatory partner MOB1. MOB1 subsequently phosphorylates and inactivates the YAP1 oncoprotein and WWTR1/TAZ. TEAD4 functions by mediating the gene expression of YAP1 and WWTR1/TAZ, thereby overseeing cellular processes such as proliferation, migration, and epithelial-mesenchymal transition (EMT) induction. The protein exhibits specific and non-cooperative binding to the Sph and GT-IIC 'enhansons' (5'-GTGGAATGT-3'), activating transcription, and also interacts with the M-CAT motif. TEAD4's intricate interactions with YAP1 and WWTR1/TAZ underscore its central role in the regulatory dynamics of this signaling pathway.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q15561 (74M-434E)

Gene ID
Molecular Construction
N-term
6*His
TEAD4 (74M-434E)
Accession # Q15561
C-term
Synonyms
EFTR 2; EFTR2; hRTEF 1B; hRTEF1B; TEAD 4; TEAD-4; TEAD4; TEAD4_HUMAN; TEF 3; TEF3; TEFR 1; TEFR1; Transcription factor 13 (SV40 transcriptional enhancer factor) like 1; Transcription factor 13 like 1; Transcription factor 13-like 1; Transcription factor RTEF 1; Transcription factor RTEF-1; Transcription factor RTEF1; Transcriptional enhancer factor 1 related; Transcriptional enhancer factor 3
AA Sequence

MYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQAAKDKALQSMAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE

Molecular Weight

Approximately 44.7 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against solution in 10 mM Tris-HC1, 1 mM EDTA, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TEAD4 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TEAD4 Protein, Human (His)
Cat. No.:
HY-P71535
Quantity:
MCE Japan Authorized Agent: