1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TDGF1 Protein, Mouse (HEK293, His)

TDGF1, a GPI-anchored protein, participates in Nodal signaling pathways as a coreceptor in cis. Shedding by Tmem8a dynamically regulates Nodal signaling, releasing soluble TDGF1. This shedding mechanism modulates the Nodal pathway and suggests a role in determining the fate of epiblastic cells, particularly in mesoderm formation. TDGF1 also interacts with ACVR1B, emphasizing its importance in cellular responses. TDGF1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TDGF1 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TDGF1, a GPI-anchored protein, participates in Nodal signaling pathways as a coreceptor in cis. Shedding by Tmem8a dynamically regulates Nodal signaling, releasing soluble TDGF1. This shedding mechanism modulates the Nodal pathway and suggests a role in determining the fate of epiblastic cells, particularly in mesoderm formation. TDGF1 also interacts with ACVR1B, emphasizing its importance in cellular responses. TDGF1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TDGF1 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

TDGF1, a glycosylphosphatidylinositol (GPI)-anchored cell membrane protein, actively participates in Nodal signaling pathways. Functioning as a Nodal coreceptor, TDGF1 operates in cis, and its cell-associated form acts synergistically with the signaling molecule. Notably, shedding of TDGF1 by Tmem8a dynamically regulates Nodal signaling by releasing soluble TDGF1, enabling it to serve as a Nodal coreceptor on neighboring cells. This shedding mechanism introduces a level of modulation to the Nodal pathway. TDGF1's involvement in these signaling cascades suggests a potential role in determining the fate of epiblastic cells, particularly those contributing to the formation of the mesoderm. Additionally, TDGF1 interacts with the activin type-1 receptor ACVR1B, further highlighting its significance in mediating crucial cellular responses.

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Rat Activin RIB is immobilized at 2 µg/mL(100 µL/well) can bind Recombinant Mouse TDGF1. The ED50 for this effect is 61.03 ng/mL.

  • Measured by its binding ability in a functional ELISA. When Recombinant Rat Activin RIB is immobilized at 2 µg/mL (100 µL/well) can bind Recombinant Mouse TDGF1 . The ED50 for this effect is 61.03 ng/mL.
Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

P51865 (R26-Q150)

Gene ID

21667

Molecular Construction
N-term
TDGF1 (R26-Q150)
Accession # P51865
6*His
C-term
Synonyms
CFC-2; CR; Cripto; Cripto-1 growth factor; Cripto-1; CRIPTOCRGF; Epidermal growth factor-like cripto protein CR1; TDGF1; TDGF-1; teratocarcinoma-derived growth factor 1
AA Sequence

RDLAIRDNSIWDQKEPAVRDRSFQFVPSVGIQNSKSLNKTCCLNGGTCILGSFCACPPSFYGRNCEHDVRKEHCGSILHGTWLPKKCSLCRCWHGQLHCLPQTFLPGCDGHVMDQDLKASGTPCQ

Molecular Weight

Approximately 19-23 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.2.

Endotoxin Level

<0.1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in PBS. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TDGF1 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TDGF1 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P702506
Quantity:
MCE Japan Authorized Agent: