Syndecan-4 Protein, Human

Studies have proven that Syndecan-4 protein is a cell surface proteoglycan that cooperates with SDCBP and PDCD6IP to play a key role in regulating exosome biogenesis. Syndecan-4 functions as a homodimer and interacts with various intracellular partners through its cytoplasmic domain. Syndecan-4 Protein, Human is the recombinant human-derived Syndecan-4 protein, expressed by E. coli , with tag free.

Syndecan-4, a cell surface proteoglycan, emerges as a pivotal regulator of exosome biogenesis, working in collaboration with SDCBP and PDCD6IP. It forms homodimers and engages in interactions with various proteins, including GIPC through its cytoplasmic domain and NUDT16L1. Syndecan-4 further interacts with CDCP1 and SDCBP, emphasizing its involvement in diverse cellular processes and signaling pathways. The complex interplay between Syndecan-4 and these interacting partners underscores its multifunctional role at the cell surface, suggesting potential contributions to exosome dynamics and other cellular activities.

Human

E. coli

Tag Free

P31431-1 (E19-E145)

6385  [NCBI]

ESIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNIFERTE

Approximately 24 kDa

Greater than 95% as determined by reducing SDS-PAGE

<1 EU/μg, determined by LAL method.