Syndecan-4 Protein, Human

Studies have proven that Syndecan-4 protein is a cell surface proteoglycan that cooperates with SDCBP and PDCD6IP to play a key role in regulating exosome biogenesis. Syndecan-4 functions as a homodimer and interacts with various intracellular partners through its cytoplasmic domain. Syndecan-4 Protein, Human is the recombinant human-derived Syndecan-4 protein, expressed by E. coli , with tag free.

Syndecan-4, a cell surface proteoglycan, emerges as a pivotal regulator of exosome biogenesis, working in collaboration with SDCBP and PDCD6IP. It forms homodimers and engages in interactions with various proteins, including GIPC through its cytoplasmic domain and NUDT16L1. Syndecan-4 further interacts with CDCP1 and SDCBP, emphasizing its involvement in diverse cellular processes and signaling pathways. The complex interplay between Syndecan-4 and these interacting partners underscores its multifunctional role at the cell surface, suggesting potential contributions to exosome dynamics and other cellular activities.

Measured by its binding ability in a functional ELISA. Immobilized Syndecan-4 at 500ng/mL (100μL/well) can bind bFGF (HY-P7331A). The ED₅₀ for this effect is 7.830 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Syndecan-4 at 500ng/mL (100μL/well) can bind bFGF (HY-P7331A). The ED₅₀ for this effect is 7.830 ng/mL.

Human

E. coli

Tag Free

P31431-1 (E19-E145)

6385  [NCBI]

ESIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNIFERTE

Approximately 24 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.