1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. SULT4A1 Protein, Human

SULT4A1 Protein, an atypical sulfotransferase, shows low PAPS affinity and minimal catalytic activity toward substrates like L-triiodothyronine and estrone.Despite limited efficiency, SULT4A1 may impact drug and neurotransmitter metabolism in the central nervous system (CNS).SULT4A1 Protein, Human is the recombinant human-derived SULT4A1 protein, expressed by E.coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SULT4A1 Protein, an atypical sulfotransferase, shows low PAPS affinity and minimal catalytic activity toward substrates like L-triiodothyronine and estrone.Despite limited efficiency, SULT4A1 may impact drug and neurotransmitter metabolism in the central nervous system (CNS).SULT4A1 Protein, Human is the recombinant human-derived SULT4A1 protein, expressed by E.coli , with tag free.

Background

SULT4A1, a member of the atypical sulfotransferase family, exhibits notably low affinity for 3'-phospho-5'-adenylyl sulfate (PAPS) and displays minimal catalytic activity towards various substrates, including L-triiodothyronine, thyroxine, estrone, p-nitrophenol, 2-naphthylamine, and 2-beta-naphthol. Despite its limited catalytic efficiency, SULT4A1 may play a role in the metabolism of drugs and neurotransmitters within the central nervous system (CNS).

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q9BR01 (M1-L284)

Gene ID
Molecular Construction
N-term
SULT4A1 (M1-L284)
Accession # Q9BR01
C-term
Protein Length

Full Length

Synonyms
Sulfotransferase 4A1; ST4A1; Brain Sulfotransferase-Like Protein; hBR-STL; hBR-STL-1; Nervous System Sulfotransferase; NST; SULT4A1; SULTX3
AA Sequence

MAESEAETPSTPGEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPKSGTSLLQEVVYLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIKELTSPRLIKSHLPYRFLPSDLHNGDSKVIYMARNPKDLVVSYYQFHRSLRTMSYRGTFQEFCRRFMNDKLGYGSWFEHVQEFWEHRMDSNVLFLKYEDMHRDLVTMVEQLARFLGVSCDKAQLEALTEHCHQLVDQCCNAEALPVGRGRVGLWKDIFTVSMNEKFDLVYKQKMGKCDLTFDFYL

Molecular Weight

Approximately 34.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, 150 mM NaCl, 8% sucrose, 0.05% Tween 80, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

SULT4A1 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SULT4A1 Protein, Human
Cat. No.:
HY-P71344
Quantity:
MCE Japan Authorized Agent: