1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. SULT1E1 Protein, Human (N-His)

The SULT1E1 protein is a sulfotransferase that critically regulates estrogen homeostasis by sulfating estradiol and estrone, resulting in hormone inactivation. Its versatility extends to sulfated DHEA, pregnenolone, and xenobiotics such as ethinyl estradiol. SULT1E1 Protein, Human (N-His) is the recombinant human-derived SULT1E1 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The SULT1E1 protein is a sulfotransferase that critically regulates estrogen homeostasis by sulfating estradiol and estrone, resulting in hormone inactivation. Its versatility extends to sulfated DHEA, pregnenolone, and xenobiotics such as ethinyl estradiol. SULT1E1 Protein, Human (N-His) is the recombinant human-derived SULT1E1 protein, expressed by E. coli , with N-His labeled tag.

Background

SULT1E1 protein, a sulfotransferase utilizing 3'-phospho-5'-adenylyl sulfate (PAPS) as a sulfonate donor, plays a pivotal role in estrogen homeostasis by catalyzing the sulfate conjugation of estradiol and estrone, contributing to the inactivation of these hormones. Beyond its primary function in estrogen metabolism, SULT1E1 demonstrates versatility by sulfating dehydroepiandrosterone (DHEA), pregnenolone, (24S)-hydroxycholesterol, and various xenobiotic compounds such as ethinylestradiol, equalenin, diethyl stilbesterol, and 1-naphthol, albeit with lower efficiency. Notably, SULT1E1 does not sulfonate cortisol, testosterone, and dopamine. Moreover, this sulfotransferase may be implicated in gut microbiota-host metabolic interactions, as it O-sulfonates 4-ethylphenol (4-EP), a tyrosine-derived metabolite produced by gut bacteria. The resulting product, 4-EPS, crosses the blood-brain barrier and potentially exerts regulatory effects on oligodendrocyte maturation and myelination, influencing the functional connectivity of brain regions associated with the limbic system. The diverse substrate specificity of SULT1E1 highlights its crucial role in hormonal regulation and suggests its involvement in broader physiological processes, including gut-brain interactions with potential implications for neurological functions.

Biological Activity

Measured by its ability to transfer sulfate from PAPS to 1-Napthol. The specific activity is 74.44 pmol/min/μg that incubate at 37 ºC for 20 minutes.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P49888 (N2-I294)

Gene ID

6783

Molecular Construction
N-term
His
SULT1E1 (N2-I294)
Accession # P49888
C-term
Protein Length

Partial

Synonyms
Sulfotransferase 1E1; ST1E1; EST-1; Estrogen sulfotransferase; STE
AA Sequence

NSELDYYEKFEEVHGILMYKDFVKYWDNVEAFQARPDDLVIATYPKSGTTWVSEIVYMIYKEGDVEKCKEDVIFNRIPFLECRKENLMNGVKQLDEMNSPRIVKTHLPPELLPASFWEKDCKIIYLCRNAKDVAVSFYYFFLMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDRIIHHTSFQEMKNNPSTNYTTLPDEIMNQKLSPFMRKGITGDWKNHFTVALNEKFDKHYEQQMKESTLKFRTEI

Molecular Weight

Approximately 36 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 200 mM NaCl, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

SULT1E1 Protein, Human (N-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SULT1E1 Protein, Human (N-His)
Cat. No.:
HY-P76099A
Quantity:
MCE Japan Authorized Agent: