1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. SULT1A3 Protein, Human (N-His)

SULT1A3 protein, a sulfotransferase utilizing PAPS, catalyzes the sulfate conjugation of phenolic monoamines, including neurotransmitters (dopamine, norepinephrine, serotonin) and drugs. This activity contributes significantly to inactivation and elimination, emphasizing SULT1A3's crucial role in regulating neurotransmitter and drug levels, maintaining homeostasis, and ensuring proper biological system functioning. SULT1A3 Protein, Human (N-His) is the recombinant human-derived SULT1A3, expressed by E. coli , with N-6*His labeled tag. ,

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SULT1A3 protein, a sulfotransferase utilizing PAPS, catalyzes the sulfate conjugation of phenolic monoamines, including neurotransmitters (dopamine, norepinephrine, serotonin) and drugs. This activity contributes significantly to inactivation and elimination, emphasizing SULT1A3's crucial role in regulating neurotransmitter and drug levels, maintaining homeostasis, and ensuring proper biological system functioning. SULT1A3 Protein, Human (N-His) is the recombinant human-derived SULT1A3, expressed by E. coli , with N-6*His labeled tag. ,

Background

SULT1A3 protein, a sulfotransferase utilizing 3'-phospho-5'-adenylyl sulfate (PAPS) as its sulfonate donor, plays a pivotal role in catalyzing the sulfate conjugation of phenolic monoamines, including neurotransmitters such as dopamine, norepinephrine, and serotonin, as well as phenolic and catechol drugs. This enzymatic activity contributes significantly to the inactivation and elimination of these bioactive molecules, highlighting SULT1A3's crucial role in regulating the levels and activity of neurotransmitters and certain pharmacologically relevant compounds. The substrate specificity of SULT1A3 underscores its importance in modulating physiological responses to neurotransmitters and drugs, emphasizing its significance in maintaining homeostasis and proper functioning of biological systems.

Biological Activity

Measured by its ability to transfer sulfate from PAPS to 1-Napthol. The specific activity is 855.567 pmol/min/μg that incubate at 37 ºC for 20 minutes.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P0DMM9-1 (M1-L295)

Gene ID

445329

Synonyms
Sulfotransferase 1A3/1A4; ST1A3/ST1A4; Aryl Sulfotransferase 1A3/1A4; Catecholamine-Sulfating Phenol Sulfotransferase; HAST3; M-PST; Monoamine-Sulfating Phenol Sulfotransferase; Placental Estrogen Sulfotransferase; Sulfotransferase Monoamine-Preferring; Thermolabi
AA Sequence

MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL

Molecular Weight

Approximately 35 kDa.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose, 8% mannitol and 0.02% Tween80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

SULT1A3 Protein, Human (N-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SULT1A3 Protein, Human (N-His)
Cat. No.:
HY-P71341A
Quantity:
MCE Japan Authorized Agent: