1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. SULT1A3 Protein, Human (His)

SULT1A3 protein, a sulfotransferase utilizing PAPS, catalyzes the sulfate conjugation of phenolic monoamines, including neurotransmitters (dopamine, norepinephrine, serotonin) and drugs. This activity contributes significantly to inactivation and elimination, emphasizing SULT1A3's crucial role in regulating neurotransmitter and drug levels, maintaining homeostasis, and ensuring proper biological system functioning. SULT1A3 Protein, Human (His) is the recombinant human-derived SULT1A3 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SULT1A3 protein, a sulfotransferase utilizing PAPS, catalyzes the sulfate conjugation of phenolic monoamines, including neurotransmitters (dopamine, norepinephrine, serotonin) and drugs. This activity contributes significantly to inactivation and elimination, emphasizing SULT1A3's crucial role in regulating neurotransmitter and drug levels, maintaining homeostasis, and ensuring proper biological system functioning. SULT1A3 Protein, Human (His) is the recombinant human-derived SULT1A3 protein, expressed by E. coli , with N-6*His labeled tag.

Background

SULT1A3 protein, a sulfotransferase utilizing 3'-phospho-5'-adenylyl sulfate (PAPS) as its sulfonate donor, plays a pivotal role in catalyzing the sulfate conjugation of phenolic monoamines, including neurotransmitters such as dopamine, norepinephrine, and serotonin, as well as phenolic and catechol drugs. This enzymatic activity contributes significantly to the inactivation and elimination of these bioactive molecules, highlighting SULT1A3's crucial role in regulating the levels and activity of neurotransmitters and certain pharmacologically relevant compounds. The substrate specificity of SULT1A3 underscores its importance in modulating physiological responses to neurotransmitters and drugs, emphasizing its significance in maintaining homeostasis and proper functioning of biological systems.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P0DMM9-1 (M1-L295)

Gene ID

445329  [NCBI]

Molecular Construction
N-term
6*His
SULT1A3 (M1-L295)
Accession # P0DMM9-1
C-term
Protein Length

Full Length of Isoform-1

Synonyms
Sulfotransferase 1A3/1A4; ST1A3/ST1A4; Aryl Sulfotransferase 1A3/1A4; Catecholamine-Sulfating Phenol Sulfotransferase; HAST3; M-PST; Monoamine-Sulfating Phenol Sulfotransferase; Placental Estrogen Sulfotransferase; Sulfotransferase Monoamine-Preferring; Thermolabi
AA Sequence

MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL

Molecular Weight

Approximately 35.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 100 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

SULT1A3 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SULT1A3 Protein, Human (His)
Cat. No.:
HY-P71341
Quantity:
MCE Japan Authorized Agent: