1. Recombinant Proteins
  2. Others
  3. Streptokinase G Protein, Streptococcus sp. (His)

Streptokinase G Protein, Streptococcus sp. (His)

Cat. No.: HY-P71922A
Handling Instructions Technical Support

Streptokinase G protein, devoid of protease activity, complexes with plasminogen, inducing its activation. Serving as a potential virulence factor, Streptokinase G is implicated in hindering robust fibrin barriers at infection sites, potentially augmenting microbial pathogenicity. Its activation of plasminogen highlights its role in manipulating the host's fibrinolytic system—a strategy employed to evade defenses and enhance infection. Streptokinase G Protein, Streptococcus sp. (His) is the recombinant Streptokinase G protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Streptokinase G protein, devoid of protease activity, complexes with plasminogen, inducing its activation. Serving as a potential virulence factor, Streptokinase G is implicated in hindering robust fibrin barriers at infection sites, potentially augmenting microbial pathogenicity. Its activation of plasminogen highlights its role in manipulating the host's fibrinolytic system—a strategy employed to evade defenses and enhance infection. Streptokinase G Protein, Streptococcus sp. (His) is the recombinant Streptokinase G protein, expressed by E. coli , with N-6*His labeled tag.

Background

Streptokinase G protein, despite not being a protease itself, functions by forming complexes with plasminogen, leading to the activation of plasminogen. As a potential virulence factor, Streptokinase G is believed to play a role in impeding the formation of effective fibrin barriers around the site of infection. This mechanism is thought to contribute to the invasiveness of the cells by preventing the establishment of robust fibrin defenses, potentially enhancing the pathogenicity of the microorganism. The activation of plasminogen by Streptokinase G underscores its significance in modulating the host's fibrinolytic system and represents a strategy employed by the microorganism to evade host defenses and facilitate infection.

Biological Activity

Fully biologically active when compared to standard. The specific activity determined by using chromogenic substrate s-2251 that incubate at 37°C for 10 minutes is 8.71 × 10^4 IU/mg.

Species

Others

Source

E. coli

Tag

N-6*His

Accession

P10519 (I27-K440)

Gene ID

/

Molecular Construction
N-term
6*His
Streptokinase G (I27-K440)
Accession # P10519
C-term
Protein Length

Full Length of Mature Protein

Synonyms
skg; Streptokinase G
AA Sequence

IAGPEWLLDRPSVNNSQLVVSVAGTVEGTNQDISLKFFEIDLTSRPAHGGKTEQGLSPKSKLFATDSGAMPHKLEKADLLKAIQEQLIANVHSNDDYFEVIDFASDATITDRNGKVYFADKDGSVTLPIQPVQEFLLKGHVRVRPYKEKPVQNQAKSVDVEYTVQFTPLNPDDDFRPALKDTKLLKTLAIGDTITSQELLAQAQSILNKNHPGYTIYERDSSIVTHDNDIFRTILPMDQEFTYHVKNREQAYRINKKSGLNEEINNTDLISEKYYVLKKGEKPYDPFDRSHLKLFTIKYVDVNTNELLKSEQLLTASERNLDFRDLYDPRDKAKLLYNNLDAFGIMDYTLTGKVEDNHDDTNRIITVYMGKRPEGENASYHLAYDKDRYTEEEREVYSYLRYTGTPIPDNPNDK

Molecular Weight

Predict MW: 48.16 kDa; Approximately 50 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Streptokinase G Protein, Streptococcus sp. (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Streptokinase G Protein, Streptococcus sp. (His)
Cat. No.:
HY-P71922A
Quantity:
MCE Japan Authorized Agent: