1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. STEAP1 Protein, Mouse (Cell-Free, His)

The STEAP1 protein is classified as a member of the metal reductase family and cannot function as a functional metal reductase, mainly due to the lack of binding sites for the electron-donating substrate NADPH. This unique feature distinguishes STEAP1 from typical metal reductases, which are characterized by their ability to catalyze the reduction of metal ions using NADPH as an electron donor. STEAP1 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived STEAP1 protein, expressed by E. coli Cell-free , with C-10*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The STEAP1 protein is classified as a member of the metal reductase family and cannot function as a functional metal reductase, mainly due to the lack of binding sites for the electron-donating substrate NADPH. This unique feature distinguishes STEAP1 from typical metal reductases, which are characterized by their ability to catalyze the reduction of metal ions using NADPH as an electron donor. STEAP1 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived STEAP1 protein, expressed by E. coli Cell-free , with C-10*His labeled tag.

Background

STEAP1 (Six-Transmembrane Epithelial Antigen of the Prostate 1) protein, as indicated by available information, does not operate as a metalloreductase primarily because it lacks binding sites for the electron-donating substrate NADPH. Metalloreductases play a crucial role in cellular processes by reducing metal ions, but the absence of NADPH binding sites in STEAP1 suggests a distinct functional profile. This observation highlights the importance of understanding the structural and biochemical features of STEAP1 in elucidating its role within cellular pathways. Further research is necessary to uncover the specific functions and implications associated with STEAP1, both in normal cellular processes and potential connections to diseases or physiological conditions, as its distinctive characteristics may contribute to its unique role within the cellular environment. (

Species

Mouse

Source

E. coli Cell-free

Tag

C-10*His

Accession

Q9CWR7 (M1-L339)

Gene ID

70358

Molecular Construction
N-term
STEAP1 (M1-L339)
Accession # Q9CWR7
10*His
C-term
Synonyms
Metalloreductase STEAP1; Six-transmembrane epithelial antigen of prostate 1
AA Sequence

MEISDDVTNPEQLWKMKPKGNLEDDSYSTKDSGETSMLKRPGLSHLQHAVHVDAFDCPSELQHTQEFFPNWRLPVKVAAIISSLTFLYTLLREIIYPLVTSREQYFYKIPILVINKVLPMVAITLLALVYLPGELAAVVQLRNGTKYKKFPPWLDRWMLARKQFGLLSFFFAVLHAVYSLSYPMRRSYRYKLLNWAYKQVQQNKEDAWVEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTVHALVFAWNKWVDVSQFVWYMPPTFMIAVFLPTLVLICKIALCLPCLRKKILKIRCGWEDVSKINRTEMASRL

Molecular Weight

40.7 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Documentation

STEAP1 Protein, Mouse (Cell-Free, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
STEAP1 Protein, Mouse (Cell-Free, His)
Cat. No.:
HY-P702448
Quantity:
MCE Japan Authorized Agent: