STEAP1 Protein, Human (HEK293, His, Twin-Strep)

STEAP1 protein lacks the necessary binding sites for the electron-donating substrate NADPH, therefore it does not function as a metalloreductase. However, when fused to the NADPH-binding domain of STEAP4, it can facilitate the reduction of Fe(3+). STEAP1 Protein, Human (HEK293, His, Twin-Strep) is the recombinant human-derived STEAP1 protein, expressed by HEK293, with C-His and N-Twin-Strep labeled tag.

STEAP1 Protein, a member of the six-transmembrane epithelial antigen of the prostate family, is involved in iron regulation and tumor progression. It is overexpressed in various cancers and contributes to cell proliferation and metastasis. The potential of STEAP1 Protein as a therapeutic target and its role in cancer development make it a subject of interest in oncology research.

Human

HEK293

C-His;N-Twin-Strep

Q9UHE8 (E2-L339)

26872

Partial

ESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDIKQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQL

Approximately 40-42 kDa & 80 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Greater than 85% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 50 mM HEPES, 150 mM NaCl, Buffer A, pH7.5 with glycerol as protectant.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.