1. Recombinant Proteins
  2. Others
  3. Stathmin Protein, Human (C-His)

Stathmin proteins critically regulate the microtubule filament system by actively destabilizing microtubules, inhibiting assembly, and promoting disassembly. Phosphorylation of Ser-16 is critical for axon formation during neurogenesis, highlighting its importance in neuronal development. Stathmin Protein, Human (C-His) is the recombinant human-derived Stathmin protein, expressed by E. coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Stathmin proteins critically regulate the microtubule filament system by actively destabilizing microtubules, inhibiting assembly, and promoting disassembly. Phosphorylation of Ser-16 is critical for axon formation during neurogenesis, highlighting its importance in neuronal development. Stathmin Protein, Human (C-His) is the recombinant human-derived Stathmin protein, expressed by E. coli , with C-6*His labeled tag.

Background

The Stathmin Protein plays a crucial role in regulating the microtubule filament system by actively destabilizing microtubules, thereby preventing their assembly and promoting disassembly. The phosphorylation of Stathmin at Ser-16 may be a key requirement for axon formation during neurogenesis, emphasizing its significance in neuronal development. Beyond its role in cellular architecture, Stathmin is implicated in the control of both learned and innate fear, indicating its potential involvement in complex behavioral processes. The protein binds to two alpha/beta-tubulin heterodimers, forming interactions critical for its microtubule-regulating functions. Additionally, Stathmin interacts with KIST, further expanding its network of molecular associations and suggesting its involvement in diverse cellular processes.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

P16949-1 (A2-D149)

Gene ID
Molecular Construction
N-term
Stathmin (A2-D149)
Accession # P16949-1
6*His
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
Stathmin; Leukemia-Associated Phosphoprotein p18; Metablastin; Oncoprotein 18; Op18; Phosphoprotein p19; pp19; Prosolin; Protein Pr22; pp17; STMN1; C1orf215; LAP18; OP18
AA Sequence

ASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD

Molecular Weight

Approximately 20.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

Stathmin Protein, Human (C-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Stathmin Protein, Human (C-His)
Cat. No.:
HY-P71121
Quantity:
MCE Japan Authorized Agent: