1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. Staphylokinase Protein, Staphylococcus phage (His)

Staphylokinase Protein, Staphylococcus phage (His)

Cat. No.: HY-P71923A
Handling Instructions Technical Support

Staphylococcal kinase protein is a potent plasminogen activator that converts plasminogen into active plasmin. In addition to activation, staphylococcal kinase forms a 1:1 complex with plasmin, enabling activated plasmin to catalyze the conversion of other plasminogen molecules. Staphylokinase Protein, Staphylococcus phage (His) is the recombinant mouse-derived Staphylokinase protein, expressed by E. coli , with N-6*His labeled tag. The total length of Staphylokinase Protein, Staphylococcus phage (His) is 136 a.a., with molecular weight of ~17 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Staphylococcal kinase protein is a potent plasminogen activator that converts plasminogen into active plasmin. In addition to activation, staphylococcal kinase forms a 1:1 complex with plasmin, enabling activated plasmin to catalyze the conversion of other plasminogen molecules. Staphylokinase Protein, Staphylococcus phage (His) is the recombinant mouse-derived Staphylokinase protein, expressed by E. coli , with N-6*His labeled tag. The total length of Staphylokinase Protein, Staphylococcus phage (His) is 136 a.a., with molecular weight of ~17 kDa.

Background

Staphylokinase Protein emerges as a potent plasminogen activator, facilitating the conversion of plasminogen into its active form, plasmin. This enzymatic process is pivotal in the fibrinolytic system, as Staphylokinase not only serves as an activator but also forms a 1:1 complex with plasmin. In this complex, plasmin is activated and gains the ability to further catalyze the conversion of additional plasminogen molecules. The intricate interplay between Staphylokinase and plasmin underscores the protein's role as a key regulator in the fibrinolytic cascade, contributing to the dissolution of blood clots and highlighting its potential therapeutic applications in promoting clot resolution.

Biological Activity

Fully biologically active when compared to standard. The specific activity determined by using chromogenic substrate s-2251 that incubate at 37°C for 10 minutes is 5.30 × 104 IU/mg.

Species

Others

Source

E. coli

Tag

N-6*His

Accession

P15240 (S28-K163)

Gene ID

/

Molecular Construction
N-term
6*His
Staphylokinase (S28-K163)
Accession # P15240
C-term
Protein Length

Full Length of Mature Protein

Synonyms
sak; Staphylokinase; Sak42D
AA Sequence

SSSFDKGKYKKGDDASYFEPTGPYLMVNVTGVDGKRNELLSPRYVEFPIKPGTTLTKEKIEYYVEWALDATAYKEFRVVELDPSAKIEVTYYDKNKKKEETKSFPITEKGFVVPDLSEHIKNPGFNLITKVVIEKK

Predicted Molecular Mass
16.4 kDa
Molecular Weight

Approximately 18 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm solution of 50 mM HEPES, 150 mM NaCl, pH 6.8, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Staphylokinase Protein, Staphylococcus phage (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Staphylokinase Protein, Staphylococcus phage (His)
Cat. No.:
HY-P71923A
Quantity:
MCE Japan Authorized Agent: