1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. ST8SIA1 Protein, Human (HEK293, His)

The ST8SIA1 protein links sialic acid to ganglioside GM3 via an α 2,8-bond to form ganglioside GD3. ST8SIA1 Protein, Human (HEK293, His) is the recombinant human-derived ST8SIA1 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The ST8SIA1 protein links sialic acid to ganglioside GM3 via an α 2,8-bond to form ganglioside GD3. ST8SIA1 Protein, Human (HEK293, His) is the recombinant human-derived ST8SIA1 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

ST8SIA1 protein catalyzes the addition of sialic acid in alpha 2,8-linkage to the sialic acid moiety of ganglioside GM3, leading to the formation of ganglioside GD3. Gangliosides represent a subfamily of complex glycosphingolipids characterized by the presence of one or more sialic acid residues. This enzymatic activity extends to the potential addition of a second alpha-2,8-sialic acid to GD3, resulting in the formation of GT3. ST8SIA1 can also utilize GM1b, GD1a, and GT1b as acceptor substrates to synthesize GD1c, GT1a, and GQ1b, respectively. Notably, in breast cancer cells, ST8SIA1 exhibits the ability to synthesize unconventional tetra- and pentasialylated lactosylceramide derivatives identified as GQ3 (II3Neu5Ac4-Gg2Cer) and GP3 (II3Neu5Ac5-Gg2Cer). This diverse enzymatic repertoire underscores ST8SIA1's role in ganglioside biosynthesis, contributing to the structural complexity and functional diversity of these glycosphingolipids in cellular processes and disease contexts.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q92185 (Y49-S356)

Gene ID
Molecular Construction
N-term
ST8SIA1 (Y49-S356)
Accession # Q92185
6*His
C-term
Synonyms
Alpha-N-Acetylneuraminide Alpha-2; 8-Sialyltransferase; Alpha-2; 8-Sialyltransferase 8A; Ganglioside GD3 Synthase; Ganglioside GT3 Synthase; Sialyltransferase 8A; SIAT8-A; Sialytransferase St8Sia I; ST8SiaI; ST8SIA1; SIAT8; SIAT8A
AA Sequence

YRLPNEKEIVQGVLQQGTAWRRNQTAARAFRKQMEDCCDPAHLFAMTKMNSPMGKSMWYDGEFLYSFTIDNSTYSLFPQATPFQLPLKKCAVVGNGGILKKSGCGRQIDEANFVMRCNLPPLSSEYTKDVGSKSQLVTANPSIIRQRFQNLLWSRKTFVDNMKIYNHSYIYMPAFSMKTGTEPSLRVYYTLSDVGANQTVLFANPNFLRSIGKFWKSRGIHAKRLSTGLFLVSAALGLCEEVAIYGFWPFSVNMHEQPISHHYYDNVLPFSGFHAMPEEFLQLWYLHKIGALRMQLDPCEDTSLQPTS

Molecular Weight

Approximately 48.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

ST8SIA1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ST8SIA1 Protein, Human (HEK293, His)
Cat. No.:
HY-P71334
Quantity:
MCE Japan Authorized Agent: