1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. ST6GALNAC2 Protein, Human (HEK293, His)

The ST6GALNAC2 protein is an essential enzyme that catalyzes the transfer of N-acetylneuramidyl groups to glycan chains in glycoproteins. This glycosyltransferase shows a preference for N-acetylgalactosamine (GalNAc) residues that have been modified by the addition of galactose or galactose followed by the addition of sialic acid in an α-2,3 linkage. ST6GALNAC2 Protein, Human (HEK293, His) is the recombinant human-derived ST6GALNAC2 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The ST6GALNAC2 protein is an essential enzyme that catalyzes the transfer of N-acetylneuramidyl groups to glycan chains in glycoproteins. This glycosyltransferase shows a preference for N-acetylgalactosamine (GalNAc) residues that have been modified by the addition of galactose or galactose followed by the addition of sialic acid in an α-2,3 linkage. ST6GALNAC2 Protein, Human (HEK293, His) is the recombinant human-derived ST6GALNAC2 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

ST6 N-Acetylgalactosaminide Alpha-2,6-Sialyltransferase 2 (ST6GALNAC2) is an enzyme that catalyzes the transfer of N-acetylneuraminyl groups onto glycan chains in glycoproteins. This sialyltransferase exhibits a preference for glycan structures where N-acetylgalactosamine (GalNAc) residues are already modified by the addition of galactose or galactose followed by sialic acid in alpha-2,3 linkage. The enzymatic activity of ST6GALNAC2 contributes to the addition of sialic acid residues to glycoproteins, modulating their functional properties and interactions. Sialylation is a crucial post-translational modification with implications in cell adhesion, immune response, and signaling. Understanding the substrate specificity of ST6GALNAC2 provides insights into its role in the intricate regulation of glycan structures and their impact on diverse cellular processes.

Biological Activity

Measured by its ability to transfer Neu5Ac from 250 µM CMP-Neu5Ac to 0.5 mg fetuin of fetal calf serum. which can be measured by absorbance at 620 nm that incubate at 37℃ .The specific activity is 825.741 pmol/min/μg.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q9UJ37 (S29-R374)

Gene ID

10610  [NCBI]

Molecular Construction
N-term
ST6GALNAC2 (S29-R374)
Accession # Q9UJ37
6*His
C-term
Protein Length

Lumenal Domain

Synonyms
Alpha-N-Acetylgalactosaminide Alpha-2; 6-Sialyltransferase 2; GalNAc Alpha-2; 6-Sialyltransferase II; ST6GalNAc II; ST6GalNAcII; SThM; Sialyltransferase 7B; SIAT7-B; ST6GALNAC2; SIAT7B; SIATL1; STHM
AA Sequence

SAVQRYPGPAAGARDTTSFEAFFQSKASNSWTGKGQACRHLLHLAIQRHPHFRGLFNLSIPVLLWGDLFTPALWDRLSQHKAPYGWRGLSHQVIASTLSLLNGSESAKLFAPPRDTPPKCIRCAVVGNGGILNGSRQGPNIDAHDYVFRLNGAVIKGFERDVGTKTSFYGFTVNTMKNSLVSYWNLGFTSVPQGQDLQYIFIPSDIRDYVMLRSAILGVPVPEGLDKGDRPHAYFGPEASASKFKLLHPDFISYLTERFLKSKLINTHFGDLYMPSTGALMLLTALHTCDQVSAYGFITSNYWKFSDHYFERKMKPLIFYANHDLSLEAALWRDLHKAGILQLYQR

Molecular Weight

Approximately 44.0 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, 5 mM EDTA, 5% trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

ST6GALNAC2 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ST6GALNAC2 Protein, Human (HEK293, His)
Cat. No.:
HY-P71332
Quantity:
MCE Japan Authorized Agent: