1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. ST3GAL3 Protein, Human (His-SUMO)

ST3GAL3 protein plays a central role in cellular processes by catalyzing the formation of NeuAc-alpha-2,3-Gal-beta-1,4-GlcNAc-, NeuAc-alpha-2,3-Gal-beta-1,3-GlcNAc- and NeuAc-α-2,3-Gal-beta-1,3-GalNAc- sequences are present in the terminal carbohydrate groups of glycoproteins and glycolipids. ST3GAL3 Protein, Human (His-SUMO) is the recombinant human-derived ST3GAL3 protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ST3GAL3 protein plays a central role in cellular processes by catalyzing the formation of NeuAc-alpha-2,3-Gal-beta-1,4-GlcNAc-, NeuAc-alpha-2,3-Gal-beta-1,3-GlcNAc- and NeuAc-α-2,3-Gal-beta-1,3-GalNAc- sequences are present in the terminal carbohydrate groups of glycoproteins and glycolipids. ST3GAL3 Protein, Human (His-SUMO) is the recombinant human-derived ST3GAL3 protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Background

ST3GAL3, or sialyltransferase 3, is an enzyme that catalyzes the formation of terminal carbohydrate sequences on glycoproteins and glycolipids. Specifically, it is responsible for adding sialic acid to the Gal-beta-1,3-GlcNAc, Gal-beta-1,3-GlcNAc, and Gal-beta-1,3-GalNAc structures, resulting in the formation of NeuAc-alpha-2,3-Gal-beta-1,4-GlcNAc, NeuAc-alpha-2,3-Gal-beta-1,3-GlcNAc, and NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc sequences. These sialylation events play a crucial role in modulating the structure and function of glycoproteins and glycolipids, impacting various cellular processes. ST3GAL3 exhibits varying degrees of activity towards different substrates, with the highest activity observed towards Gal-beta-1,3-GlcNAc and the lowest towards Gal-beta-1,3-GalNAc. It has to succinctly outline ST3GAL3's role in catalyzing the addition of sialic acid to specific carbohydrate structures, highlighting its contribution to the diversity of terminal glycan sequences in biological molecules.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

N-His;N-SUMO

Accession

Q11203 (29K-375I)

Gene ID
Molecular Construction
N-term
6*His-SUMO
ST3GAL3 (29K-375I)
Accession # Q11203
C-term
Protein Length

Lumenal Domain

Synonyms
3 sialyltransferase; 3(4) GlcNAc alpha-2; 3-sialyltransferase 3; 3-sialyltransferase; 3-ST 3; 4-galactoside alpha-2; 4GlcNAc alpha 2 3 sialyltransferase; Alpha 2 3 sialyltransferase II; Alpha 2 3 sialyltransferase III; Alpha 2 3 ST 3; Alpha 2; Beta galactoside alpha 3 sialyltransferase 3; Beta-galactoside alpha-2; CMP N acetylneuraminate beta 1 4 galactoside alpha 2 3 sialyltransferase; CMP-N-acetylneuraminate-beta-1; EC 2.4.99.6; Gal beta 1 3; Gal beta 1 3(4) GlcNAc alpha 2 3 sialyltransferase; Gal beta 1 3(4)GlcNAc alpha 2 3 sialyltransferase; Gal beta-1; N acetyllactosaminide alpha 2 3 sialyltransferase; N-acetyllactosaminide alpha-2; OTTHUMP00000008820; OTTHUMP00000008821; OTTHUMP00000008822; OTTHUMP00000008823; Sialyltransferase 6 (N acetyllacosaminide alpha 2 3 sialyltransferase); Sialyltransferase 6; SIAT6; SIAT6_HUMAN; ST3 beta galactoside alpha 2 3 sialyltransferase 3; ST3 beta galactoside alpha 2,3 sialyltransferase 3; ST3Gal III; St3gal3; ST3GALII; ST3GalIII; ST3N
AA Sequence

KLHLLQWEEDSNSVVLSFDSAGQTLGSEYDRLGFLLNLDSKLPAELATKYANFSEGACKPGYASALMTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLRCRRCIIVGNGGVLANKSLGSRIDDYDIVVRLNSAPVKGFEKDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLKYIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIPTLGSVAVTMALHGCDEVAVAGFGYDMSTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITDLSSGI

Molecular Weight

Approximately 54.9 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against solution in 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ST3GAL3 Protein, Human (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ST3GAL3 Protein, Human (His-SUMO)
Cat. No.:
HY-P71529
Quantity:
MCE Japan Authorized Agent: