1. Recombinant Proteins
  2. Receptor Proteins
  3. G-Protein-Coupled Receptors (GPCRs)
  4. Somatostatin Receptor
  5. SSTR2 Protein-VLP, Human (HEK293, His)

SSTR2 Protein-VLP, Human (HEK293, His) is recommended for animal immunization, ELISA, FACS. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P701236. Tags can only be detected under denaturing conditions.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
20 μg In-stock
50 μg Get quote
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SSTR2 Protein-VLP, Human (HEK293, His) is recommended for animal immunization, ELISA, FACS. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P701236. Tags can only be detected under denaturing conditions.

Background

The SSTR2 Protein-VLP serves as a receptor for somatostatin-14 and -28, coupling with pertussis toxin-sensitive G proteins to inhibit adenylyl cyclase. Additionally, it stimulates phosphotyrosine phosphatase and PLC through pertussis toxin-insensitive and sensitive G proteins, while inhibiting calcium entry by suppressing voltage-dependent calcium channels. In pancreatic alpha- and beta-cells, SSTR2 acts as the functionally dominant somatostatin receptor, mediating the inhibitory effects of somatostatin-14 on hormone secretion. Beyond its role in pancreatic cells, SSTR2 inhibits cell growth by enhancing MAPK1 and MAPK2 phosphorylation, leading to the up-regulation of CDKN1B. It further contributes to neuronal migration and axon outgrowth, potentially participating in neuron development and maturation during brain development. SSTR2 mediates the negative regulation of insulin receptor signaling through PTPN6 and inactivates SSTR3 receptor function following heterodimerization. Existing as both homodimers and heterodimers with SSTR3 and SSTR5, SSTR2 undergoes agonist-induced dissociation into monomers, a crucial step for receptor internalization. Interactions with beta-arrestin and SHANK1 further modulate receptor internalization and function.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Human SSTR2 at 1 μg/well can bind Anti-SSTR2 recombinant antibod, the EC50is 70.87 - 130.6 ng/mL.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P30874 (M1-I369)

Gene ID
Molecular Construction
N-term
SSTR2-VLP (M1-I369)
Accession # P30874
6*His
C-term
Protein Length

Full Length

Synonyms
SSTR2; somatostatin receptor 2; somatostatin receptor type 2; SS2R; SRIF-1; SS-2-R
AA Sequence

MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVLTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI

Molecular Weight

42.5 kDa

Glycosylation
Yes
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

SSTR2 Protein-VLP, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SSTR2 Protein-VLP, Human (HEK293, His)
Cat. No.:
HY-P700430
Quantity:
MCE Japan Authorized Agent: