1. Recombinant Proteins
  2. Others
  3. SRSF1 Protein, Human (His-SUMO)

The SRSF1 protein plays a crucial role in splicing regulation, preventing exon skipping and ensuring splicing accuracy. It interacts with spliceosome components and forms a bridge between 5'- and 3'-splice site binding elements. SRSF1 Protein, Human (His-SUMO) is the recombinant human-derived SRSF1 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The SRSF1 protein plays a crucial role in splicing regulation, preventing exon skipping and ensuring splicing accuracy. It interacts with spliceosome components and forms a bridge between 5'- and 3'-splice site binding elements. SRSF1 Protein, Human (His-SUMO) is the recombinant human-derived SRSF1 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Background

SRSF1 protein plays a crucial role in maintaining splicing fidelity by preventing exon skipping and regulating alternative splicing. Its interaction with spliceosomal components, facilitated by RS domains, establishes a bridge between the 5'- and 3'-splice site binding elements, U1 snRNP and U2AF. SRSF1 exhibits preferential binding to purine-rich RNA sequences, acting as a splicing enhancer in vitro through the ASF/SF2 splicing enhancer (ASE). While isoforms ASF-2 and ASF-3 function as splicing repressors, SRSF1 may also serve as an export adapter in mRNA nuclear export via the TAP/NXF1 pathway. Within the spliceosome C complex, it collaborates with other RNA-binding proteins, including DDX5, HNRNPH2, and splicing regulator ARVCF. SRSF1's extensive interactome involves proteins such as SAFB/SAFB1, PSIP1/LEDGF, RSRC1, ZRSR2/U2AF1-RS2, CCDC55, SRPK1, NXF1, CCNL1, CCNL2, CDK11B, and RRP1B, showcasing its multifaceted roles in RNA processing and cellular functions. Additionally, its interaction with TNPO3 facilitates nuclear import when phosphorylated in the RS domain, and it interacts with ILDR1 and ILDR2.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Human SRSF1, at 2 μg/mL (100μL/well) can bind Anti-SRSF1 antibody. The ED50 for this effect is ≤6.802 ng/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Human SRSF1, at 2 μg/mL (100 μL/well) can bind Anti-SRSF1 antibody. The ED50 for this effect is 6.802 ng/mL.
Species

Human

Source

E. coli

Tag

N-SUMO;N-6*His

Accession

Q07955-1 (S2-T248)

Gene ID
Molecular Construction
N-term
6*His-SUMO
SRSF1 (S2-T248)
Accession # Q07955
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
Alternative-splicing factor 1; ASF-1Splicing factor; arginine/serine-rich 1pre-mRNA-splicing factor SF2; P33 subunit
AA Sequence

SGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSRSRSRSRSRSNSRSRSYSPRRSRGSPRYSPRHSRSRSRT

Molecular Weight

Approximately 43 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 200 mM NaCl, 0.1%SKL, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

SRSF1 Protein, Human (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SRSF1 Protein, Human (His-SUMO)
Cat. No.:
HY-P700524
Quantity:
MCE Japan Authorized Agent: