1. Recombinant Proteins
  2. Others
  3. SPRR2B Protein, Human (P.pastoris, Myc, His)

SPRR2B protein, a cross-linked envelope protein in keratinocytes, starts in the cytosol and undergoes transglutaminase-facilitated cross-linking with membrane proteins. This results in the formation of an insoluble envelope beneath the plasma membrane, emphasizing SPRR2B's vital role in the structural integrity and organization of keratinocytes. SPRR2B Protein, Human (P.pastoris, Myc, His) is the recombinant human-derived SPRR2B protein, expressed by P. pastoris , with N-His, C-Myc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SPRR2B protein, a cross-linked envelope protein in keratinocytes, starts in the cytosol and undergoes transglutaminase-facilitated cross-linking with membrane proteins. This results in the formation of an insoluble envelope beneath the plasma membrane, emphasizing SPRR2B's vital role in the structural integrity and organization of keratinocytes. SPRR2B Protein, Human (P.pastoris, Myc, His) is the recombinant human-derived SPRR2B protein, expressed by P. pastoris , with N-His, C-Myc labeled tag.

Background

SPRR2B protein, a cross-linked envelope protein found in keratinocytes, undergoes a distinctive cellular journey. Initially present in the cell cytosol, SPRR2B ultimately undergoes cross-linking with membrane proteins facilitated by transglutaminase. This process culminates in the formation of an insoluble envelope situated beneath the plasma membrane, highlighting SPRR2B's crucial role in the structural integrity and organization of keratinocytes.

Species

Human

Source

P. pastoris

Tag

N-His;C-Myc

Accession

P35325 (M1-K72)

Gene ID

6701  [NCBI]

Molecular Construction
N-term
10*His
SPRR2B (M1-K72)
Accession # P35325
Myc
C-term
Protein Length

Full Length

Synonyms
SPRR2B; Small proline-rich protein 2B; SPR-2B
AA Sequence

MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQPKYPPKSK

Predicted Molecular Mass
12.0 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

SPRR2B Protein, Human (P.pastoris, Myc, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SPRR2B Protein, Human (P.pastoris, Myc, His)
Cat. No.:
HY-P71787
Quantity:
MCE Japan Authorized Agent: