1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Protease Inhibitors
  4. SPINK7 Protein, Human (HEK293, His)

SPINK7 Protein, a probable serine protease inhibitor, suggests a role in modulating serine protease activity, crucial in diverse biological processes. Its participation likely regulates proteolytic activities, influencing cellular homeostasis and signaling pathways. Further exploration of specific targeted serine proteases and biological contexts will offer insights into SPINK7's role in cellular processes and potential therapeutic applications. SPINK7 Protein, Human (HEK293, His) is the recombinant human-derived SPINK7 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SPINK7 Protein, a probable serine protease inhibitor, suggests a role in modulating serine protease activity, crucial in diverse biological processes. Its participation likely regulates proteolytic activities, influencing cellular homeostasis and signaling pathways. Further exploration of specific targeted serine proteases and biological contexts will offer insights into SPINK7's role in cellular processes and potential therapeutic applications. SPINK7 Protein, Human (HEK293, His) is the recombinant human-derived SPINK7 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The SPINK7 protein is identified as a probable serine protease inhibitor. This characterization suggests its potential role in modulating the activity of serine proteases, enzymes involved in various biological processes. As a serine protease inhibitor, SPINK7 likely participates in the regulation of proteolytic activities, with implications for cellular homeostasis and the modulation of signaling pathways. Further investigation into the specific serine proteases targeted by SPINK7 and the biological contexts in which it functions will provide valuable insights into its role in cellular processes and potential therapeutic applications.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P58062 (S20-C85)

Gene ID
Molecular Construction
N-term
SPINK7 (S20-C85)
Accession # P58062
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
SPINK7; ECRG-2; Esophagus cancer-related gene 2 protein; Serine protease inhibitor Kazal-type 7; ECG2
AA Sequence

SEAASLSPKKVDCSIYKKYPVVAIPCPITYLPVCGSDYITYGNECHLCTESLKSNGRVQFLHDGSC

Molecular Weight

11&13 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 300 mM NaCl, pH8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

SPINK7 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SPINK7 Protein, Human (HEK293, His)
Cat. No.:
HY-P71331
Quantity:
MCE Japan Authorized Agent: