1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. Sphingomyelin Synthase 2/SGMS2 Protein, Human (HEK293, Fc)

Sphingomyelin Synthase 2/SGMS2 Protein, Human (HEK293, Fc)

Cat. No.: HY-P73632
Handling Instructions Technical Support

The sphingomyelin synthase 2 (SGMS2) protein plays a crucial role in plasma membrane sphingomyelin synthesis. It catalyzes the reversible transfer of the phosphocholine moiety in sphingomyelin biosynthesis to form ceramide phosphocholine. Sphingomyelin Synthase 2/SGMS2 Protein, Human (HEK293, Fc) is the recombinant human-derived Sphingomyelin Synthase 2/SGMS2 protein, expressed by HEK293 , with N-mFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The sphingomyelin synthase 2 (SGMS2) protein plays a crucial role in plasma membrane sphingomyelin synthesis. It catalyzes the reversible transfer of the phosphocholine moiety in sphingomyelin biosynthesis to form ceramide phosphocholine. Sphingomyelin Synthase 2/SGMS2 Protein, Human (HEK293, Fc) is the recombinant human-derived Sphingomyelin Synthase 2/SGMS2 protein, expressed by HEK293 , with N-mFc labeled tag.

Background

Sphingomyelin Synthase 2 (SGMS2) protein serves as a key contributor to sphingomyelin synthesis and maintenance at the plasma membrane. This enzyme facilitates the reversible transfer of the phosphocholine moiety in sphingomyelin biosynthesis, catalyzing the formation of ceramide phosphocholine (sphingomyelin) from phosphatidylcholine and ceramide. The direction of this reaction is influenced by the levels of ceramide and diacylglycerol in the plasma membrane. Additionally, SGMS2 can transfer the phosphoethanolamine head group of phosphatidylethanolamine onto ceramide to generate ceramide phosphoethanolamine. Beyond its role in sphingolipid metabolism, SGMS2 regulates receptor-mediated signal transduction by modulating diacylglycerol and ceramide levels, impacting mitogenic and proapoptotic signaling. Moreover, SGMS2 contributes to secretory transport and influences Golgi apparatus function, notably affecting the downstream effects on PRKD1. Its involvement in these cellular processes highlights its significance in maintaining membrane structure, regulating signal transduction, and impacting bone matrix mineralization.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

HEK293

Tag

N-mFc

Accession

Q8NHU3 (M1-T79)

Gene ID
Molecular Construction
N-term
mFc
SGMS2 (M1-T79)
Accession # Q8NHU3
C-term
Protein Length

Partial

Synonyms
Phosphatidylcholine:ceramide cholinephosphotransferase 2; Sphingomyelin synthase 2; SGMS2; SMS2
AA Sequence

MDIIETAKLEEHLENQPSDPTNTYARPAEPVEEENKNGNGKPKSLSSGLRKGTKKYPDYIQIAMPTESRNKFPLEWWKT

Molecular Weight

Approximately 35.7 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Sphingomyelin Synthase 2/SGMS2 Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Sphingomyelin Synthase 2/SGMS2 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P73632
Quantity:
MCE Japan Authorized Agent: