1. Recombinant Proteins
  2. Others
  3. SPG21 Protein, Human (sf9, His)

The SPG21 protein may act as a negative regulator in CD4-dependent T cell activation, suggesting its role in regulating immune responses. Its interaction with CD4 suggests a molecular link affecting CD4-mediated T cell activation pathways. SPG21 Protein, Human (sf9, His) is the recombinant human-derived SPG21 protein, expressed by Sf9 insect cells , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The SPG21 protein may act as a negative regulator in CD4-dependent T cell activation, suggesting its role in regulating immune responses. Its interaction with CD4 suggests a molecular link affecting CD4-mediated T cell activation pathways. SPG21 Protein, Human (sf9, His) is the recombinant human-derived SPG21 protein, expressed by Sf9 insect cells , with N-His labeled tag.

Background

The SPG21 protein is suggested to potentially function as a negative regulatory factor in CD4-dependent T-cell activation, indicating its involvement in modulating immune responses. It interacts with CD4, suggesting a molecular association that may impact CD4-mediated T-cell activation pathways. Additionally, SPG21 interacts with ALDH16A1, indicating its potential participation in cellular processes associated with the aldehyde dehydrogenase family. The specific mechanisms underlying SPG21's regulatory role in T-cell activation and its interaction with ALDH16A1 remain areas of interest, highlighting its potential significance in immune regulation and cellular metabolism.

Species

Human

Source

Sf9 insect cells

Tag

N-6*His

Accession

Q9NZD8-1 (M1-Q308)

Gene ID
Molecular Construction
N-term
6*His
SPG21 (M1-Q308)
Accession # Q9NZD8-1
C-term
Protein Length

Full Length of Isoform-1

Synonyms
Maspardin; Acid cluster protein 33; ACP33; BM-019; GL010; Spastic paraplegia 21 protein
AA Sequence

MGEIKVSPDYNWFRGTVPLKKIIVDDDDSKIWSLYDAGPRSIRCPLIFLPPVSGTADVFFRQILALTGWGYRVIALQYPVYWDHLEFCDGFRKLLDHLQLDKVHLFGASLGGFLAQKFAEYTHKSPRVHSLILCNSFSDTSIFNQTWTANSFWLMPAFMLKKIVLGNFSSGPVDPMMADAIDFMVDRLESLGQSELASRLTLNCQNSYVEPHKIRDIPVTIMDVFDQSALSTEAKEEMYKLYPNARRAHLKTGGNFPYLCRSAEVNLYVQIHLLQFHGTKYAAIDPSMVSAEELEVQKGSLGISQEEQ

Molecular Weight

Approximately 35 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, 150 mM NaCl, pH 8.0, 50% glycerol.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

SPG21 Protein, Human (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SPG21 Protein, Human (sf9, His)
Cat. No.:
HY-P77212
Quantity:
MCE Japan Authorized Agent: