1. Recombinant Proteins
  2. Others
  3. SPARC Protein, Rat (HEK293, His)

SPARC protein is involved in the regulation of cell growth and may play a regulatory role by affecting the interaction of extracellular matrix and cytokines. SPRC protein can bind calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell membranes. It has two calcium binding sites: one is an acidic domain that can bind 5-8 Ca2+ with low affinity, and the other is an EF-hand loop that can bind Ca2+ ions with high affinity. SPARC Protein, Rat (HEK293, His) is the recombinant rat-derived SPARC protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SPARC protein is involved in the regulation of cell growth and may play a regulatory role by affecting the interaction of extracellular matrix and cytokines. SPRC protein can bind calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell membranes. It has two calcium binding sites: one is an acidic domain that can bind 5-8 Ca2+ with low affinity, and the other is an EF-hand loop that can bind Ca2+ ions with high affinity. SPARC Protein, Rat (HEK293, His) is the recombinant rat-derived SPARC protein, expressed by HEK293 , with C-His labeled tag.

Background

SPARC protein is a cysteine-rich acidic secreted protein, also known as osteonectin or BM-40, and is a matricellular protein that regulates cell adhesion, extracellular matrix production, growth factor activity, and cell cycle. SPARC protein does not play a structural function, but has anti-proliferative and anti-adhesive properties that can regulate the interaction between cells and the surrounding extracellular matrix. SPRC protein is able to bind to Ca and Cu, several types of collagen, albumin, thrombospondin, PDGF, and cell membranes. It has two calcium binding sites: one is an acidic domain that can bind 5-8 Ca2+ with low affinity, and the other is an EF-hand ring that can bind Ca2+ ions with high affinity. SPARC is overexpressed in sites of injury, regeneration, obesity, cancer, and inflammation, and is a potential target and therapeutic indicator for disease treatment and evaluation.

Biological Activity

Measured by its ability to inhibit the cell growth of Mv-1-Lu mink lung epithelial cells. The ED50 for this effect is typically 3.581μg/mL, corresponding to a specific activity is 2.793×102 U/mg.

  • Measured by its ability to inhibit the cell growth of Mv-1-Lu mink lung epithelial cells. The ED50 for this effect is typically 3.581 μg/mL, corresponding to a specific activity is 2.793×102 U/mg.
Species

Rat

Source

HEK293

Tag

C-His

Accession

P16975 (A18-I301)

Gene ID
Molecular Construction
N-term
SPARC (A18-I301)
Accession # P16975
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
SPARC; BM-40; Osteonectin; ON; Secreted Protein Acidic and Rich in Cysteine
AA Sequence

APQTEAAEEMVAEETVVEETGLPVGANPVQVEMGEFEEGAEETVEEVVAENPCQNHHCKHGKVCELDESNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIAPCLDSELTEFPLRMRDWLKNVLVTLYERDEGNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALEEWAGCFGIKEQDINKDLVI

Molecular Weight

Approximately 33.8-40 kDa

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

SPARC Protein, Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SPARC Protein, Rat (HEK293, His)
Cat. No.:
HY-P73420
Quantity:
MCE Japan Authorized Agent: