1. Recombinant Proteins
  2. Others
  3. Somatoliberin/GHRH Protein, Human (HEK293, Fc)

Somatoliberin/GHRH Protein, Human (HEK293, Fc)

Cat. No.: HY-P70240
Handling Instructions Technical Support

The ghrelin/GHRH protein, also known as GRF (Growth Hormone Releasing Factor), is released by the hypothalamus and plays a key role in growth hormone regulation. It stimulates the pituitary gland to secrete growth hormone, which coordinates body growth and development. Somatoliberin/GHRH Protein, Human (HEK293, Fc) is the recombinant human-derived Somatoliberin/GHRH protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The ghrelin/GHRH protein, also known as GRF (Growth Hormone Releasing Factor), is released by the hypothalamus and plays a key role in growth hormone regulation. It stimulates the pituitary gland to secrete growth hormone, which coordinates body growth and development. Somatoliberin/GHRH Protein, Human (HEK293, Fc) is the recombinant human-derived Somatoliberin/GHRH protein, expressed by HEK293 , with C-hFc labeled tag.

Background

The Somatoliberin/GHRH Protein, also known as GRF (Growth Hormone-Releasing Factor), is released by the hypothalamus, playing a pivotal role in the regulation of growth hormone secretion. Upon release, this protein acts on the adenohypophysis, stimulating the secretion of growth hormone. The intricate communication between the hypothalamus and the adenohypophysis, mediated by Somatoliberin/GHRH, is essential for orchestrating the body's growth and development processes. By initiating the release of growth hormone, this protein contributes to the regulation of key physiological functions, emphasizing its central role in the endocrine control of growth and metabolism.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

P01286-1 (P21-L75)

Gene ID
Molecular Construction
N-term
GHRH (P21-L75)
Accession # P01286-1
hFc
C-term
Protein Length

Full Length of Somatoliberin (with Propeptide)

Synonyms
rHuSomatoliberin/GHRH, Fc; Somatoliberin; Growth hormone-releasing factor; Somatocrinin; Somatorelin; Growth hormone-releasing hormone; GHRH; GHRF
AA Sequence

PPPPLTLRMRRYADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

Molecular Weight

Approximately 36.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Somatoliberin/GHRH Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Somatoliberin/GHRH Protein, Human (HEK293, Fc)
Cat. No.:
HY-P70240
Quantity:
MCE Japan Authorized Agent: