1. Recombinant Proteins
  2. Others
  3. SMUG1 Protein, Human (His-SUMO)

SMUG1 protein is a single-function DNA glycosylase that plays a crucial role in base excision DNA repair, especially the recognition and repair of uracil (U) residues, preferentially recognizing mismatches (U/G) rather than matching (U/A).Its activity extends to the excision of 5-formyluracil (fU), 5-hydroxyuracil (hoU) and 5-hydroxymethyluracil (hmU) in single-stranded (ssDNA) and double-stranded DNA (dsDNA).SMUG1 Protein, Human (His-SUMO) is the recombinant human-derived SMUG1 protein, expressed by E.coli , with N-His, N-SUMO labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SMUG1 protein is a single-function DNA glycosylase that plays a crucial role in base excision DNA repair, especially the recognition and repair of uracil (U) residues, preferentially recognizing mismatches (U/G) rather than matching (U/A).Its activity extends to the excision of 5-formyluracil (fU), 5-hydroxyuracil (hoU) and 5-hydroxymethyluracil (hmU) in single-stranded (ssDNA) and double-stranded DNA (dsDNA).SMUG1 Protein, Human (His-SUMO) is the recombinant human-derived SMUG1 protein, expressed by E.coli , with N-His, N-SUMO labeled tag.

Background

The SMUG1 protein serves as a pivotal factor in base excision DNA repair, specifically recognizing and initiating repair processes for base lesions in the genome. Functioning as a monofunctional DNA glycosylase, SMUG1 displays specificity for uracil (U) residues in DNA, with a notable preference for single-stranded DNA substrates. Its enzymatic activity is more pronounced toward mismatches (U/G) compared to matches (U/A). SMUG1 exhibits the capability to excise not only uracil (U) but also 5-formyluracil (fU), and uracil derivatives with oxidized groups at C5, such as 5-hydroxyuracil (hoU) and 5-hydroxymethyluracil (hmU), in both single-stranded (ssDNA) and double-stranded DNA (dsDNA). Importantly, this DNA glycosylase does not act on analogous cytosine derivatives (5-hydroxycytosine and 5-formylcytosine), nor other oxidized bases. SMUG1's activity is damage-specific and exhibits dependence on salt concentration, with a substrate preference hierarchy of ssDNA > dsDNA (G pair) = dsDNA (A pair) under low salt conditions, and dsDNA (G pair) > dsDNA (A pair) > ssDNA under high salt concentrations.

Species

Human

Source

E. coli

Tag

N-His;N-SUMO

Accession

Q53HV7 (1M-177L)

Gene ID
Molecular Construction
N-term
6*His-SUMO
SMUG1 (1M-177L)
Accession # Q53HV7
C-term
Protein Length

Partial

Synonyms
FDG; HMUDG; MGC104370; Single strand selective monofunctional uracil DNA glycosylase 1; Single strand selective monofunctional uracil DNA glycosylase; Single-strand selective monofunctional uracil DNA glycosylase; SMUG 1; Smug1; SMUG1 protein; SMUG1_HUMAN; UNG 3; UNG3
AA Sequence

MPQAFLLGSIHEPAGALMEPQPCPGSLAESFLEEELRLNAELSQLQFSEPVGIIYNPVEYAWEPHRNYVTRYCQGPKEVLFLGMNPGPFGMAQTGVPFGEVSMVRDWLGIVGPVLTPPQEHPKRPVLGLECPQSEGPRQSMGHEIKSELLMGGCSWIRGKIQCDRVQVRRPGFSSQL

Predicted Molecular Mass
35.6 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

SMUG1 Protein, Human (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SMUG1 Protein, Human (His-SUMO)
Cat. No.:
HY-P71560
Quantity:
MCE Japan Authorized Agent: