SMN1 Protein, Human (His)

SMN1 Protein, Human (His) is the recombinant human-derived SMN1 protein, expressed by E. coli, with N-His tag.

The SMN complex catalyzes the assembly of small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome, playing a crucial role in the splicing of cellular pre-mRNAs. Most spliceosomal snRNPs contain a common set of Sm proteins (SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF, and SNRPG) that assemble into a heptameric protein ring on the Sm site of small nuclear RNA to form the core snRNP (Sm core). In the cytosol, the Sm proteins SNRPD1, SNRPD2, SNRPE, SNRPF, and SNRPG are trapped in an inactive 6S pICln-Sm complex by the chaperone CLNS1A, which regulates core snRNP assembly. The SMN complex accepts the trapped 5Sm proteins from CLNS1A to form an intermediate, with SMN1 acting as a structural backbone alongside GEMIN2 to gather Sm complex subunits. Binding of snRNA within 5Sm triggers the eviction of the SMN complex, allowing SNRPD3 and SNRPB to complete core snRNP assembly. The SMN complex also ensures proper splicing of U12 intron-containing genes, which may be important for normal motor and proprioceptive neuron development. Additionally, it resolves RNA-DNA hybrids formed by RNA polymerase II, which create R-loops in transcription termination regions, a critical step in proper transcription termination. It may also play a role in small nucleolar ribonucleoprotein (snoRNPs) metabolism.

Human

E. coli

N-His

Q16637-1 (A2-N294)

6606

Full Length of Isoform-1 Mature Protein

AMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPPMPGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMGFRQNQKEGRCSHSLN

Approximately 36-40 kDa & 69 kDa, based on SDS-PAGE under reducing conditions.

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from 0.22 μm filtered solution in PBS, 0.5 M Arginine, pH7.4 with trehalose as protectant.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.