1. Recombinant Proteins
  2. Others
  3. SMAC/Diablo Protein, Human (His)

SMAC/Diablo protein is a core participant in apoptosis and activates caspases in the cytochrome c/Apaf-1/caspase-9 pathway. It antagonizes inhibitors of apoptosis proteins (IAPs), inhibits the binding of BIRC6/bruce to caspases and destabilizes XIAP/BIRC4. SMAC/Diablo Protein, Human (His) is the recombinant human-derived SMAC/Diablo protein, expressed by E. coli , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SMAC/Diablo protein is a core participant in apoptosis and activates caspases in the cytochrome c/Apaf-1/caspase-9 pathway. It antagonizes inhibitors of apoptosis proteins (IAPs), inhibits the binding of BIRC6/bruce to caspases and destabilizes XIAP/BIRC4. SMAC/Diablo Protein, Human (His) is the recombinant human-derived SMAC/Diablo protein, expressed by E. coli , with C-His labeled tag.

Background

SMAC/Diablo protein plays a pivotal role in apoptosis by instigating the activation of caspases within the cytochrome c/Apaf-1/caspase-9 pathway. Its mode of action involves counteracting the inhibitory effects of inhibitor of apoptosis proteins (IAP). SMAC/Diablo effectively hinders the activity of BIRC6/bruce by impeding its binding to caspases. Furthermore, it exerts its regulatory influence on XIAP/BIRC4 by diminishing its stability and apoptosis-inhibiting capabilities. This is achieved through the facilitation of XIAP/BIRC4 ubiquitination and subsequent degradation via the ubiquitin-proteasome pathway. Notably, SMAC/Diablo disrupts the interaction between XIAP/BIRC4 and processed caspase-9, thereby promoting the activation of caspase-3. In essence, SMAC/Diablo emerges as a key orchestrator in the intricate molecular machinery governing apoptotic processes.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Human SMAC at 10 μg/mL (100 μL/well) can bind Biotinylated XIAP. The ED50 for this effect is 0.328 μg/mL.

Species

Human

Source

E. coli

Tag

C-His

Accession

Q9NR28-1 (A56-D239)

Gene ID
Molecular Construction
N-term
SMAC (A56-D239)
Accession # Q9NR28-1
His
C-term
Protein Length

Partial

Synonyms
SMAC; Diablo homolog, mitochondrial; DIABLO
AA Sequence

AVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED

Molecular Weight

Approximately 22 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

SMAC/Diablo Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SMAC/Diablo Protein, Human (His)
Cat. No.:
HY-P73416
Quantity:
MCE Japan Authorized Agent: