1. Recombinant Proteins
  2. Others
  3. SLC25A4 Protein, Human (His)

SLC25A4 Protein, Human (His) is the recombinant human-derived SLC25A4 protein, expressed by E. coli cell-free system, with N-10*His tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SLC25A4 Protein, Human (His) is the recombinant human-derived SLC25A4 protein, expressed by E. coli cell-free system, with N-10*His tag.

Background

SLC25A4 is an ADP:ATP antiporter that imports ADP into the mitochondrial matrix for ATP synthesis and exports ATP to fuel cellular processes. It cycles between cytoplasmic-open (c-state) and matrix-open (m-state) conformations via an alternating access mechanism, exposing a single substrate-binding site to either side of the inner mitochondrial membrane (By similarity). Beyond its ADP:ATP antiporter function, it participates in mitochondrial uncoupling and mitochondrial permeability transition pore (mPTP) activity. As a proton transporter, it uncouples proton flow from the electron transport chain and ATP synthase, reducing ATP production efficiency and inducing mitochondrial thermogenesis (By similarity). This proton transport activity is inhibited by ADP:ATP antiporter activity, positioning SLC25A4/ANT1 as a master regulator balancing ATP synthesis and thermogenesis (By similarity). Proton transport requires free fatty acids as cofactors but does not translocate them (By similarity). It also plays a key role in mPTP opening, though its exact role (pore component vs. regulator) remains unclear (By similarity). Independently of its antiporter activity, it promotes mitophagy by binding TIMM44 to inhibit TIMM23, thereby stabilizing PINK1 (By similarity).

Species

Human

Source

E. coli Cell-free

Tag

N-10*His

Accession

P12235 (G2-V298)

Gene ID

291

Molecular Construction
N-term
10*His
SLC25A4 (G2-V298)
Accession # P12235
C-term
Protein Length

Full Length of Mature Protein

Synonyms
ADP,ATP carrier protein 1; ADP,ATP carrier protein, heart/skeletal muscle isoform T1; Adenine nucleotide translocator 1; Solute carrier family 25 member 4
AA Sequence

GDHAWSFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQLFLGGVDRHKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKGAAQREFHGLGDCIIKIFKSDGLRGLYQGFNVSVQGIIIYRAAYFGVYDTAKGMLPDPKNVHIFVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV

Molecular Weight

Approximately 38 kDa, based on SDS-PAGE under reducing conditions.

Structure/Form
Monomer
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 0.05% Brij78,6% Trehalose, pH7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

SLC25A4 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SLC25A4 Protein, Human (His)
Cat. No.:
HY-P704169
Quantity:
MCE Japan Authorized Agent: