1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Stimulatory Immune Checkpoint Molecules NK Cell CD Proteins Macrophage CD Proteins Stem Cell CD Proteins Platelet CD Proteins
  4. CD48
  5. SLAMF2/CD48 Protein, Human (HEK293, hFc)

SLAMF2/CD48 protein is a GPI-anchored glycoprotein that regulates immune cell function by interacting with CD2 and CD244. SLAMF2/CD48 Protein, Human (HEK293, hFc) is the recombinant human-derived SLAMF2/CD48 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SLAMF2/CD48 protein is a GPI-anchored glycoprotein that regulates immune cell function by interacting with CD2 and CD244. SLAMF2/CD48 Protein, Human (HEK293, hFc) is the recombinant human-derived SLAMF2/CD48 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

The SLAMF2/CD48 Protein, a glycosylphosphatidylinositol (GPI)-anchored cell surface glycoprotein, plays a pivotal role in immune cell regulation and activation by interacting through its N-terminal immunoglobulin domain with cell surface receptors, such as 2B4/CD244 or CD2. In T-cell signaling transduction, SLAMF2 associates with CD2, facilitating the efficient recruitment of the Src family protein kinase LCK and LAT to the TCR/CD3 complex, thereby promoting LCK phosphorylation and subsequent activation. Furthermore, SLAMF2 induces the phosphorylation of the cytoplasmic immunoreceptor tyrosine switch motifs (ITSMs) of CD244, initiating a cascade of signaling events that culminate in the formation of the immunological synapse and the directed release of cytolytic granules containing perforin and granzymes by T-lymphocytes and NK-cells. Notably, SLAMF2 interacts directly with CD2, CD244, and LCK, highlighting its intricate involvement in immune cell function and signaling pathways.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized CD48 at 2 μg/mL can bind Anti-CD48 rabbit monoclonal antibody, the EC50 of human CD48 protein is 0.7847-1.107 ng/mL.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

P09326 (Q27-S220)

Gene ID

962  [NCBI]

Molecular Construction
N-term
CD48 (Q27-S220)
Accession # P09326
hFc
C-term
Protein Length

Full Length of Mature Protein

Synonyms
B-lymphocyte activation marker BLAST-1 BCM1 surface antigen; Leukocyte antigen MEM-102; SLAM family member 2; SLAMF2; Signaling lymphocytic activation molecule 2; TCT.1; CD48; BCM1; BLAST1;
AA Sequence

QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARS

Molecular Weight

Approximately 66 kDa

Glycosylation
Yes
Purity
  • Greater than 92% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SLAMF2/CD48 Protein, Human (HEK293, hFc)
Cat. No.:
HY-P72022
Quantity:
MCE Japan Authorized Agent: