1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. GST Protein, Schistosoma Japonicum

The GST (Glutathione S-transferase) protein is vital for conjugating reduced glutathione to hydrophobic electrophiles, essential for cellular detoxification and defense. GST isoenzymes play a central role in parasites' detoxification systems, indicating a crucial defense role. Additionally, GST may enhance haematin solubility in parasite guts, highlighting its multifaceted contributions to cellular and organismal processes. GST Protein, Schistosoma Japonicum is the recombinant GST protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE GST Protein, Schistosoma Japonicum

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The GST (Glutathione S-transferase) protein is vital for conjugating reduced glutathione to hydrophobic electrophiles, essential for cellular detoxification and defense. GST isoenzymes play a central role in parasites' detoxification systems, indicating a crucial defense role. Additionally, GST may enhance haematin solubility in parasite guts, highlighting its multifaceted contributions to cellular and organismal processes. GST Protein, Schistosoma Japonicum is the recombinant GST protein, expressed by E. coli , with tag free.

Background

The GST (Glutathione S-transferase) protein is integral to the cellular process of conjugating reduced glutathione to a diverse array of hydrophobic electrophiles, a crucial mechanism for detoxification and cellular defense. Beyond its role in general detoxification processes, GST isoenzymes are implicated as key components in the detoxification system of parasites, suggesting a central role in their defense mechanisms. Furthermore, there are indications that GST may have additional functions, such as enhancing the solubility of haematin in the gut of parasites, underscoring the multifaceted nature of its contributions to cellular and organismal processes.

Biological Activity

<12 units/mg, is defined as the amount of enzyme that conjugate 1.0 u mole of 1-chloro-2,4-dinitrobenzene (CDNB) with reduced glutathione per minute at at 37°C.

Species

Others

Source

E. coli

Tag

Tag Free

Accession

P08515 (M1-K218)

Gene ID

/

Molecular Construction
N-term
GST (M1-K218)
Accession # P08515
C-term
Synonyms
rSchGlutathione S-transferase class-mu 26 kDa isozyme; Glutathione S-transferase class-mu 26 kDa isozyme; GST 26; Sj26 antigen; SjGST
AA Sequence

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPK

Molecular Weight

Approximately 25.0-28.0 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

GST Protein, Schistosoma Japonicum Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GST Protein, Schistosoma Japonicum
Cat. No.:
HY-P70270
Quantity:
MCE Japan Authorized Agent: