1. Recombinant Proteins
  2. Receptor Proteins
  3. Siglec
  4. Siglec-10
  5. Siglec-10 Protein, Mouse (HEK293, Fc)

Siglec-10 protein is an adhesion molecule that mediates sialic acid-dependent cell binding, preferentially selecting α-2,3- or α-2,6-linked sialic acid. Its sialic acid recognition site may be masked through cis interactions. Siglec-10 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Siglec-10 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Siglec-10 protein is an adhesion molecule that mediates sialic acid-dependent cell binding, preferentially selecting α-2,3- or α-2,6-linked sialic acid. Its sialic acid recognition site may be masked through cis interactions. Siglec-10 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Siglec-10 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

Siglec-10 Protein, identified as a putative adhesion molecule, serves as a mediator of sialic-acid-dependent binding to cells, with a preference for alpha-2,3- or alpha-2,6-linked sialic acid. The sialic acid recognition site may undergo masking through cis interactions with sialic acids on the same cell surface. In the immune response, Siglec-10 functions as an inhibitory receptor, achieving ligand-induced tyrosine phosphorylation and recruiting cytoplasmic phosphatases via their SH2 domains to block signal transduction through the dephosphorylation of signaling molecules. Notably, it participates in the negative regulation of B-cell antigen receptor signaling, specifically acting on B1 cells to inhibit Ca(2+) signaling, cellular expansion, and antibody secretion. This inhibition is dependent on PTPN6/SHP-1. Siglec-10, in association with CD24, may be involved in selectively suppressing the immune response to danger-associated molecular patterns (DAMPs) and regulating the immune response of natural killer (NK) cells. Furthermore, it plays a role in controlling autoimmunity and, during the initiation of adaptive immune responses by CD8-alpha(+) dendritic cells, inhibits cross-presentation by impairing the formation of MHC class I-peptide complexes. Additionally, in the context of microbial infection by RNA viruses, Siglec-10 inhibits RIG-I signaling in macrophages by promoting its CBL-dependent ubiquitination and degradation via PTPN11/SHP-2. The multifaceted roles of Siglec-10 highlight its intricate involvement in diverse cellular processes and immune modulation.

Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

Q80ZE3 (M19-K543)

Gene ID
Molecular Construction
N-term
Siglec-10 (M19-K543)
Accession # Q80ZE3
hFc
C-term
Protein Length

Extracellular Domain

Synonyms
SIGLEC10; SiglecG; Siglec-G; MGC126774; PRO940; Siglec10; SLG2; sialic acid-binding Ig-like lectin 10; Siglec-10; siglec-like gene 2; Siglec-like protein 2; SLG2sialic acid binding Ig-like lectin 10 Ig-like lectin 7
AA Sequence

MESYFLQVQRIVKAQEGLCIFVPCSFSSPEGKWLNRSPLYGYWFKGIRKPSLSFPVATNNKDKVLEWEARGRFQLLGDISKKNCSLLIKDVQWGDSTNYFFRMERGFERFSFKEEFRLQVEALTQKPDIFIPEVLEPGEPVTVVCLFSWTFNQCPAPSFSWMGDAVSFQESRPHTSNYSVLSFIPGLQHHDTELTCQLDFSRMSTQRTVRLRVAYAPRSLAISIFHDNVSVPDLHENPSHLEVQQGQSLRLLCTADSQPPATLSWVLEDQVLSWSSPVGSRTLALELPWVKAGDSGHYTCQAENRLGSQQHTLDLSVLYPPQDLRVTVSQANRTVLEILRNAISLPVLEGQSLCLVCVTYSNPPANVSWAWVTQTLIPIQSSEPGVLELPLVQREHEGEFTCAAQNPLGAQRISLSLSVHYPPQMSSPSCSWEAKGLHCNCSSRAWPAPSLRWRLGEGLLEGNSSNASFTVTFSSLGPWVNSSLSLLQELGPSLWLSCESWNTHGAQTTSVLLLPDKDSATAFSK

Molecular Weight

110-135 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Siglec-10 Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Siglec-10 Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P70448
Quantity:
MCE Japan Authorized Agent: